BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0276 (693 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32811| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_32582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 >SB_32811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 378 Score = 28.7 bits (61), Expect = 4.7 Identities = 19/61 (31%), Positives = 28/61 (45%) Frame = -1 Query: 225 FFENETSQNNEAYKY*GSFIKVPIDLFVLARYTLNINGCYDCI*AVITDFDCTYVFFLYR 46 F EN YK S K +DL AR+ + +GC + I + DF C + +LY Sbjct: 84 FRENHLEILTRFYKAFESVHKYVVDLNSKARFFPSPSGCQENISLIFVDFQCESL-YLYG 142 Query: 45 I 43 + Sbjct: 143 V 143 >SB_32582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1151 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/47 (31%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = -3 Query: 430 KLCGVIRKTFKMSQRKRKQINIEDKSRII-SKLESGISNKDLTKEYG 293 ++C ++RKT K+ KR+ IE++ + SK+ES ++ T+++G Sbjct: 798 QMCEMLRKTDKLRDYKRRIREIEEREILAKSKIESSRPDES-TEDFG 843 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,389,705 Number of Sequences: 59808 Number of extensions: 398262 Number of successful extensions: 983 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -