BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0274 (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0744 - 19867604-19867686,19868075-19869872,19870777-198708... 29 3.5 08_02_1243 - 25527523-25527960,25527993-25528604 28 6.0 >09_04_0744 - 19867604-19867686,19868075-19869872,19870777-19870801, 19872313-19872710 Length = 767 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 2/59 (3%) Frame = -3 Query: 652 FINYLIHREIYEPNEENYISMTYMSLDNLNIVE-VFQLNL-KNVEEKMLYYSNKYCKKL 482 F N LI+R + +P+++ IS + +S+D + V Q+ L K++EE L+ K+C ++ Sbjct: 269 FYNELINRSMIQPSKKR-ISPS-VSVDRCRVHSMVLQIILSKSIEENQLFIIKKHCNEV 325 >08_02_1243 - 25527523-25527960,25527993-25528604 Length = 349 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 29 KRKKRNFWLFRNNLCYTSNWVIRIYCLS 112 +R+ R FWLFR C+ + RI CLS Sbjct: 19 RRRGRRFWLFRFRSCFLDRFRRRI-CLS 45 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,672,284 Number of Sequences: 37544 Number of extensions: 158696 Number of successful extensions: 281 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 281 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -