BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0273 (693 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21549| Best HMM Match : SNF (HMM E-Value=2.3e-18) 30 2.0 SB_18456| Best HMM Match : Syja_N (HMM E-Value=1.9e-12) 28 6.2 >SB_21549| Best HMM Match : SNF (HMM E-Value=2.3e-18) Length = 515 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +2 Query: 488 KLITHYVC--SMLCCFVNIYIIAWSVYILF 571 K I + +C S LCC I I+AW+ Y LF Sbjct: 364 KGIGYAICMISYLCCIYYIVILAWTFYYLF 393 >SB_18456| Best HMM Match : Syja_N (HMM E-Value=1.9e-12) Length = 660 Score = 28.3 bits (60), Expect = 6.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 124 PCTLFWLLPLLINYCTLF*WHNMY 195 P W+LP++ YC++ HNM+ Sbjct: 349 PLASSWILPVIQGYCSIVHCHNMF 372 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,092,530 Number of Sequences: 59808 Number of extensions: 388194 Number of successful extensions: 867 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -