BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0271 (690 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X13666-2|CAA31960.1| 2510|Drosophila melanogaster sevenless prot... 29 7.9 X13666-1|CAB55310.1| 2554|Drosophila melanogaster sevenless prot... 29 7.9 J03158-1|AAA28882.1| 2554|Drosophila melanogaster protein ( D.me... 29 7.9 AE014298-1543|AAF47992.2| 2554|Drosophila melanogaster CG18085-P... 29 7.9 >X13666-2|CAA31960.1| 2510|Drosophila melanogaster sevenless protein protein. Length = 2510 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +3 Query: 603 RATWATVLRNCCVRTTGWAGYR--VPTWQAS 689 R W + RNC VR W+G R +P ++A+ Sbjct: 967 RVYWTDLARNCVVRMDPWSGSRELLPVFEAN 997 >X13666-1|CAB55310.1| 2554|Drosophila melanogaster sevenless protein protein. Length = 2554 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +3 Query: 603 RATWATVLRNCCVRTTGWAGYR--VPTWQAS 689 R W + RNC VR W+G R +P ++A+ Sbjct: 1011 RVYWTDLARNCVVRMDPWSGSRELLPVFEAN 1041 >J03158-1|AAA28882.1| 2554|Drosophila melanogaster protein ( D.melanogaster sevenlessprotein gene, complete cds. ). Length = 2554 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +3 Query: 603 RATWATVLRNCCVRTTGWAGYR--VPTWQAS 689 R W + RNC VR W+G R +P ++A+ Sbjct: 1011 RVYWTDLARNCVVRMDPWSGSRELLPVFEAN 1041 >AE014298-1543|AAF47992.2| 2554|Drosophila melanogaster CG18085-PA protein. Length = 2554 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +3 Query: 603 RATWATVLRNCCVRTTGWAGYR--VPTWQAS 689 R W + RNC VR W+G R +P ++A+ Sbjct: 1011 RVYWTDLARNCVVRMDPWSGSRELLPVFEAN 1041 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,850,603 Number of Sequences: 53049 Number of extensions: 607400 Number of successful extensions: 1426 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1426 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3005453946 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -