BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0271 (690 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81094-5|CAB03149.2| 675|Caenorhabditis elegans Hypothetical pr... 29 2.4 AF536544-1|AAN77185.1| 675|Caenorhabditis elegans SR-related CT... 29 2.4 Z66499-6|CAA91299.2| 765|Caenorhabditis elegans Hypothetical pr... 28 7.2 >Z81094-5|CAB03149.2| 675|Caenorhabditis elegans Hypothetical protein F58G11.5 protein. Length = 675 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Frame = -1 Query: 576 PFRLRDDSNLHRGGGRSPP----TGAGLSTSPSPANKQYT*NN 460 P LR+DS R RSPP S SPSP +Q + +N Sbjct: 507 PENLREDSEARRSNSRSPPRDHKRSRSPSRSPSPRRRQRSSSN 549 >AF536544-1|AAN77185.1| 675|Caenorhabditis elegans SR-related CTD associated factor 6 protein. Length = 675 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Frame = -1 Query: 576 PFRLRDDSNLHRGGGRSPP----TGAGLSTSPSPANKQYT*NN 460 P LR+DS R RSPP S SPSP +Q + +N Sbjct: 507 PENLREDSEARRSNSRSPPRDHKRSRSPSRSPSPRRRQRSSSN 549 >Z66499-6|CAA91299.2| 765|Caenorhabditis elegans Hypothetical protein T01B7.6 protein. Length = 765 Score = 27.9 bits (59), Expect = 7.2 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = +2 Query: 158 IYIFIDNFSSKLKFNEPYLYDQQRLGN*LPSKSSQLKNSCHSFYFSPPCQLQ 313 IYIF + KF +YD R +P + ++N+ H PP +Q Sbjct: 115 IYIFRQEEAHGCKFVAWAIYDDTRKTTSVPPTPTDIQNTSHMKKLGPPTAVQ 166 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,940,681 Number of Sequences: 27780 Number of extensions: 312235 Number of successful extensions: 641 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -