BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0270 (395 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ786658-1|CAH10353.1| 431|Homo sapiens Ka36 protein protein. 28 9.7 >AJ786658-1|CAH10353.1| 431|Homo sapiens Ka36 protein protein. Length = 431 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -3 Query: 303 QEY--LLDK*ARDNIS*NKFWGSTGASRSELNCT-ASGVCVAKEQC 175 QEY LLD AR N +WG + S L+C+ S +C + C Sbjct: 370 QEYQVLLDVKARLEGEINTYWGLLDSEDSRLSCSPCSTICTSSNTC 415 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,689,187 Number of Sequences: 237096 Number of extensions: 852109 Number of successful extensions: 4939 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4911 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4939 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2813442310 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -