BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= prgv0270
(395 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ786658-1|CAH10353.1| 431|Homo sapiens Ka36 protein protein. 28 9.7
>AJ786658-1|CAH10353.1| 431|Homo sapiens Ka36 protein protein.
Length = 431
Score = 28.3 bits (60), Expect = 9.7
Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 3/46 (6%)
Frame = -3
Query: 303 QEY--LLDK*ARDNIS*NKFWGSTGASRSELNCT-ASGVCVAKEQC 175
QEY LLD AR N +WG + S L+C+ S +C + C
Sbjct: 370 QEYQVLLDVKARLEGEINTYWGLLDSEDSRLSCSPCSTICTSSNTC 415
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 48,689,187
Number of Sequences: 237096
Number of extensions: 852109
Number of successful extensions: 4939
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4911
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4939
length of database: 76,859,062
effective HSP length: 82
effective length of database: 57,417,190
effective search space used: 2813442310
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -