BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0270 (395 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60470.1 68414.m06808 galactinol synthase, putative similar t... 28 2.6 At2g01810.1 68415.m00111 PHD finger family protein contains Pfam... 26 7.9 >At1g60470.1 68414.m06808 galactinol synthase, putative similar to galactinol synthase GI:5608497 from [Ajuga reptans] Length = 334 Score = 27.9 bits (59), Expect = 2.6 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +2 Query: 128 VVQCFCARE*SYKAYKHCSFATQTPLAVQFSSDREAPVEP 247 V+ CFC + S+ + Q P V + D E+P P Sbjct: 143 VMDCFCEKTWSHSLQYSIGYCQQCPEKVTWPEDMESPPPP 182 >At2g01810.1 68415.m00111 PHD finger family protein contains Pfam profile: PF00628: PHD-finger Length = 697 Score = 26.2 bits (55), Expect = 7.9 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 352 NQHFVTRRTLPRHNNLTRIFTRQIGPG 272 N V+ + LP H L R FTR + PG Sbjct: 527 NHLTVSCQVLPNHEELLRDFTRLLPPG 553 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,190,757 Number of Sequences: 28952 Number of extensions: 122632 Number of successful extensions: 207 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 565902384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -