BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0267 (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0268 + 1989069-1989293,1989938-1990020,1990136-1990357,199... 29 4.6 08_02_0388 + 16603720-16603987,16604022-16604420,16604569-16604582 28 6.0 >06_01_0268 + 1989069-1989293,1989938-1990020,1990136-1990357, 1990434-1990621,1990711-1990835,1990988-1991039, 1991585-1991874,1992229-1992307,1992527-1992657 Length = 464 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 245 KKAEEYNNIKCLVYYGSSC*KNIKVAISK*LSEFHHCISN 126 KKA EYN+ K VY S+ +++ V + + + + H +N Sbjct: 99 KKASEYNSHKWTVYVRSATNEDLSVIVKRVVFQLHPSFTN 138 >08_02_0388 + 16603720-16603987,16604022-16604420,16604569-16604582 Length = 226 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +3 Query: 108 WTRLHKIRYAMVKLTKLFANSNFYIFLTRTTIVYETFNI 224 W RL + KL F + F +F T + YE FNI Sbjct: 118 WARLPPLPRTFAKLESGFFDKEFIVFDTTLSPHYEVFNI 156 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,263,985 Number of Sequences: 37544 Number of extensions: 308143 Number of successful extensions: 504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -