BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0263 (687 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 66 8e-10 UniRef50_P30704 Cluster: Outer membrane pore protein E precursor... 33 8.6 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 66.1 bits (154), Expect = 8e-10 Identities = 31/56 (55%), Positives = 38/56 (67%) Frame = +3 Query: 9 GTGGLLTPLVAPVLXXXXXXXXXXXXXXXXXXYYGNLVAGSIVSQLTAAAMVAPTP 176 GTGGLLTP+VAP+L YYGN+VAGS++SQLT+AAM+APTP Sbjct: 19 GTGGLLTPIVAPMLGFGSAGIAAGSTAAAAQAYYGNVVAGSVISQLTSAAMLAPTP 74 >UniRef50_P30704 Cluster: Outer membrane pore protein E precursor; n=51; Enterobacteriaceae|Rep: Outer membrane pore protein E precursor - Klebsiella pneumoniae Length = 351 Score = 32.7 bits (71), Expect = 8.6 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -1 Query: 357 VKIMHY*IDIDIKDQNQTYLRFNHK 283 +K MHY D D KD +QTY+RF K Sbjct: 38 IKAMHYFSDYDSKDGDQTYVRFGIK 62 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,649,181 Number of Sequences: 1657284 Number of extensions: 11631466 Number of successful extensions: 19829 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19825 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53719013270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -