BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0263 (687 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical... 32 0.44 Z82060-4|CAB04885.2| 434|Caenorhabditis elegans Hypothetical pr... 28 5.4 >AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical protein Y45F10B.10 protein. Length = 1592 Score = 31.9 bits (69), Expect = 0.44 Identities = 20/53 (37%), Positives = 26/53 (49%) Frame = -2 Query: 164 YHGSSSQL*HNAAGH*ISVVCLCSSGCASCRYSR*AETEHGSH*WSQQTPSAS 6 YH +S QL GH +V CLCSS +S S + +SQ TP+ S Sbjct: 896 YHIASEQLIGTFKGHTAAVTCLCSSNDSSLFVSTSFDKTVNVWVFSQSTPTMS 948 >Z82060-4|CAB04885.2| 434|Caenorhabditis elegans Hypothetical protein T27F6.6 protein. Length = 434 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 328 NVYLIMHYFHAGMLGRLCCVLS 393 +VY HYFH+G G CV S Sbjct: 99 SVYPYFHYFHSGFTGSGVCVFS 120 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,497,682 Number of Sequences: 27780 Number of extensions: 288433 Number of successful extensions: 514 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -