BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0259 (518 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37390| Best HMM Match : MARVEL (HMM E-Value=1.1e-08) 31 0.75 SB_31430| Best HMM Match : Exo70 (HMM E-Value=2) 27 9.3 >SB_37390| Best HMM Match : MARVEL (HMM E-Value=1.1e-08) Length = 196 Score = 30.7 bits (66), Expect = 0.75 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +2 Query: 95 SCKVSLITYLSALICALSSSWESTAASTRLSVINCFMFLIELSY 226 S V + S+L+ + S W + AS ++ F+FL+E+ Y Sbjct: 120 SVGVFIFLVASSLVASYSYIWSALKASAAFGFVSAFLFLVEVVY 163 >SB_31430| Best HMM Match : Exo70 (HMM E-Value=2) Length = 853 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 25 IKYFLIYLC*FNYISSTSAMKQLVLQSFPDNVSLCP 132 +K+ +I++C NYIS+ + +LV F N S+ P Sbjct: 494 VKFLIIFVCSPNYISNPYLVAKLVEVIFVVNPSIQP 529 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,301,498 Number of Sequences: 59808 Number of extensions: 269178 Number of successful extensions: 429 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1160542895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -