BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0258 (671 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) 31 1.1 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 3.4 SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) 29 3.4 >SB_14273| Best HMM Match : DUF1000 (HMM E-Value=0) Length = 308 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 6 ASYNINSMPTFVFVKNGKKLDEFSGAN 86 A + +MPTF F KN K+DE GA+ Sbjct: 74 AKQGVTAMPTFQFFKNKVKVDEVRGAD 100 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -1 Query: 287 FFAFQRXQTQKLISSNSLQTLKTFFIHLLKT 195 F +R + KL+SSNS+ LK +HLL++ Sbjct: 803 FSKVERKKEGKLVSSNSMSKLKQKVVHLLES 833 >SB_27151| Best HMM Match : Thioredoxin (HMM E-Value=9.2e-32) Length = 456 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 9 SYNINSMPTFVFVKNGKKLDEFSGAN 86 S I +MPTF F N K+DE GA+ Sbjct: 76 SCGIRAMPTFHFYHNKAKIDELRGAD 101 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,095,105 Number of Sequences: 59808 Number of extensions: 341408 Number of successful extensions: 691 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -