BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0258 (671 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 24 1.1 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 24 1.1 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.6 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 2.6 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.1 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -3 Query: 288 IFCIPEAANTKINIFKFITDVKNIFYSFIKNVYM 187 +F I + +K+ I+K+ + +I ++ K V+M Sbjct: 80 MFLISQQKTSKLKIYKWNNQILHILWTSYKKVFM 113 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/34 (26%), Positives = 20/34 (58%) Frame = -3 Query: 288 IFCIPEAANTKINIFKFITDVKNIFYSFIKNVYM 187 +F I + +K+ I+K+ + +I ++ K V+M Sbjct: 63 MFLISQQKTSKLKIYKWNNQILHILWTSYKKVFM 96 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -2 Query: 136 LVSIYLCLRIVVLSLSTLAPE 74 LVSI +C+ +VVL++ +P+ Sbjct: 317 LVSISICVTVVVLNVHFRSPQ 337 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -2 Query: 136 LVSIYLCLRIVVLSLSTLAPE 74 LVSI +C+ +VVL++ +P+ Sbjct: 317 LVSISICVTVVVLNVHFRSPQ 337 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 435 KNKNITIHTLKFLSNHLVKKTKIE 364 ++ + I+ LKFL VK +K+E Sbjct: 335 ESNTMFINILKFLKQKYVKNSKLE 358 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,162 Number of Sequences: 438 Number of extensions: 3830 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -