SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0257
         (625 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0013 - 31007580-31007657,31007795-31007876,31007963-310080...    29   2.3  

>03_06_0013 -
           31007580-31007657,31007795-31007876,31007963-31008065,
           31008156-31008315,31009016-31009207,31009880-31010194
          Length = 309

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 16/52 (30%), Positives = 30/52 (57%)
 Frame = +3

Query: 435 LFCLKKIYLSVNVSGAIMFIIAMFYRIRITHIE*FYNLICALFKLSHLAIIG 590
           L+ L K+ L+  V G I+F+    +R R+     +YN +CA+  L+ +++ G
Sbjct: 194 LWFLHKLVLT-GVYGLIVFMYHSRWRDRLPAKPAYYNYVCAMLLLNGISLFG 244


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,005,335
Number of Sequences: 37544
Number of extensions: 250762
Number of successful extensions: 358
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 331
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 358
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1513903616
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -