BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0255 (557 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81533-11|CAE17829.1| 355|Caenorhabditis elegans Hypothetical p... 28 5.2 Z68341-4|CAA92767.2| 1266|Caenorhabditis elegans Hypothetical pr... 28 5.2 >Z81533-11|CAE17829.1| 355|Caenorhabditis elegans Hypothetical protein F36G9.16 protein. Length = 355 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -3 Query: 432 VGIQIFPWKGFISLMKGQIPHFCQCCRRKWTEYRC 328 +GI I + +S++ G +PH+ + RR T + C Sbjct: 73 IGIAICDFLRLLSVVLGALPHYYKLYRRSITPHNC 107 >Z68341-4|CAA92767.2| 1266|Caenorhabditis elegans Hypothetical protein F01G4.3 protein. Length = 1266 Score = 27.9 bits (59), Expect = 5.2 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Frame = -2 Query: 379 NPPFLPMLPEEMD*IPLPKLLSRSTGGNDTCPLCYK---TL*DDLPNI 245 N PFLP EE+D + + ++ST G ++ L +K TL + +P I Sbjct: 113 NVPFLPGFLEELDDLLAGETTAKSTSGEESKFLSFKDDATLLNTIPTI 160 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,873,928 Number of Sequences: 27780 Number of extensions: 297173 Number of successful extensions: 746 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1144922904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -