BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0254 (714 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 38 0.011 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 38 0.011 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 38 0.011 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 38 0.011 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 38 0.011 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 38 0.011 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 35 0.075 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 34 0.13 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.23 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 33 0.30 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 33 0.30 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 32 0.40 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 31 0.70 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 31 0.93 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 31 0.93 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 31 1.2 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 31 1.2 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 31 1.2 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 31 1.2 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 30 1.6 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 30 1.6 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 30 2.1 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 30 2.1 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 30 2.1 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 29 2.8 SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 29 2.8 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 29 3.7 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 29 3.7 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 29 3.7 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 29 3.7 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 29 4.9 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 29 4.9 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 29 4.9 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 29 4.9 SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) 29 4.9 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 29 4.9 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 28 6.5 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 28 6.5 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 28 6.5 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 28 6.5 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 28 6.5 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 28 6.5 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 28 6.5 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 28 6.5 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 28 6.5 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 28 6.5 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 28 6.5 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 28 6.5 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_9479| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 28 6.5 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 28 6.5 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 28 6.5 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_57479| Best HMM Match : PKD_channel (HMM E-Value=0) 28 6.5 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 28 6.5 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 28 6.5 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 28 6.5 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 28 6.5 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 28 6.5 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 28 6.5 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 28 6.5 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 28 6.5 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 28 6.5 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 28 6.5 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 6.5 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 28 6.5 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 28 6.5 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 28 6.5 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 28 6.5 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 28 6.5 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 28 6.5 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 28 6.5 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 28 6.5 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 8.6 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 28 8.6 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 28 8.6 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 28 8.6 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 28 8.6 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 28 8.6 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 28 8.6 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 28 8.6 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 28 8.6 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 28 8.6 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 28 8.6 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 28 8.6 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 28 8.6 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 28 8.6 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 28 8.6 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 28 8.6 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 28 8.6 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 28 8.6 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 28 8.6 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 28 8.6 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 28 8.6 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 28 8.6 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 28 8.6 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 28 8.6 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 28 8.6 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 28 8.6 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 28 8.6 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 28 8.6 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 28 8.6 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 28 8.6 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 28 8.6 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 28 8.6 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 28 8.6 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 28 8.6 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 28 8.6 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 8.6 SB_43882| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +1 Query: 634 IRPIVSRITIHWAVVLQRRDWGKP 705 IRPIVSRITIHW +RRDW P Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENP 41 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -1 Query: 711 TPGFSPVTTL*NDGPVNCNTTHYRANW 631 TPGF P + PVNCNTTHYRANW Sbjct: 55 TPGF-PSHDVVKRRPVNCNTTHYRANW 80 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/33 (57%), Positives = 20/33 (60%), Gaps = 5/33 (15%) Frame = +1 Query: 622 PGYPIRPI-----VSRITIHWAVVLQRRDWGKP 705 PGYP +SRITIHW VLQRRDW P Sbjct: 264 PGYPRSMADYWMALSRITIHWPSVLQRRDWENP 296 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 12 PVNCNTTHYRANW 24 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 700 FPSHDVVKRRP 668 FPSHDVVKRRP Sbjct: 2 FPSHDVVKRRP 12 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 68 PVNCNTTHYRANW 80 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 700 FPSHDVVKRRP 668 FPSHDVVKRRP Sbjct: 58 FPSHDVVKRRP 68 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 636 PVNCNTTHYRANW 648 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 700 FPSHDVVKRRP 668 FPSHDVVKRRP Sbjct: 626 FPSHDVVKRRP 636 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 47 PVNCNTTHYRANW 59 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 712 NARVFPSHDVVKRRP 668 NA+ FPSHDVVKRRP Sbjct: 33 NAKGFPSHDVVKRRP 47 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 9 PVNCNTTHYRANW 21 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 49 PVNCNTTHYRANW 61 Score = 31.9 bits (69), Expect = 0.53 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 712 NARVFPSHDVVKRRP 668 +A VFPSHDVVKRRP Sbjct: 35 HASVFPSHDVVKRRP 49 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 1887 PVNCNTTHYRANW 1899 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 703 VFPSHDVVKRRP 668 VFPSHDVVKRRP Sbjct: 1876 VFPSHDVVKRRP 1887 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 47 PVNCNTTHYRANW 59 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 712 NARVFPSHDVVKRRP 668 +A VFPSHDVVKRRP Sbjct: 33 HAIVFPSHDVVKRRP 47 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 9 PVNCNTTHYRANW 21 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 41 PVNCNTTHYRANW 53 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 712 NARVFPSHDVVKRRP 668 NA VFPSHDVVKRRP Sbjct: 27 NASVFPSHDVVKRRP 41 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 90 PVNCNTTHYRANW 102 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 700 FPSHDVVKRRP 668 FPSHDVVKRRP Sbjct: 80 FPSHDVVKRRP 90 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 79 PVNCNTTHYRANW 91 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 700 FPSHDVVKRRP 668 FPSHDVVKRRP Sbjct: 69 FPSHDVVKRRP 79 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 55 PVNCNTTHYRANW 67 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 712 NARVFPSHDVVKRRP 668 NA VFPSHDVVKRRP Sbjct: 41 NASVFPSHDVVKRRP 55 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 37.5 bits (83), Expect = 0.011 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 669 PVNCNTTHYRANW 631 PVNCNTTHYRANW Sbjct: 79 PVNCNTTHYRANW 91 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 700 FPSHDVVKRRP 668 FPSHDVVKRRP Sbjct: 69 FPSHDVVKRRP 79 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 36.3 bits (80), Expect = 0.025 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 712 NARVFPSHDVVKRRP 668 NARVFPSHDVVKRRP Sbjct: 10 NARVFPSHDVVKRRP 24 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 35.9 bits (79), Expect = 0.033 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKG 612 GF QSRRCKTTA + L + G PGK+G Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPGKRG 66 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 34.7 bits (76), Expect = 0.075 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +1 Query: 625 GYPIRPIVSRITIHW 669 G PIRPIVSRITIHW Sbjct: 37 GAPIRPIVSRITIHW 51 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 580 TEENQGSNLSGPF-LPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 T N GS F +PG P+ ++ AVVLQRRDW P Sbjct: 51 TNANDGSTAIVRFQVPGDPLESTCRHASLALAVVLQRRDWENP 93 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 712 NARVFPSHDVVKRRP 668 NA VFPSHDVVKRRP Sbjct: 10 NASVFPSHDVVKRRP 24 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 671 PSFYNVVTGENPGV 712 PSFYNVVTG+NPGV Sbjct: 9 PSFYNVVTGKNPGV 22 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 33.1 bits (72), Expect = 0.23 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 669 PVNCNTTHYRAN 634 PVNCNTTHYRAN Sbjct: 86 PVNCNTTHYRAN 97 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 712 NARVFPSHDVVKRRP 668 NAR FPSHD KRRP Sbjct: 72 NARGFPSHDGEKRRP 86 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 33.1 bits (72), Expect = 0.23 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 669 PVNCNTTHYRAN 634 PVNCNTTHYRAN Sbjct: 29 PVNCNTTHYRAN 40 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 712 NARVFPSHDVVKRRP 668 NA VF SHDVVKRRP Sbjct: 15 NASVFRSHDVVKRRP 29 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +1 Query: 625 GYPIRPIVSRITIHW 669 G PIRPIVS ITIHW Sbjct: 39 GAPIRPIVSHITIHW 53 >SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) Length = 135 Score = 32.7 bits (71), Expect = 0.30 Identities = 20/58 (34%), Positives = 29/58 (50%) Frame = +1 Query: 532 REVISCSETMMDEHITTEENQGSNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 R VI + E I ++ Q S + ++PG P+ ++ AVVLQRRDW P Sbjct: 62 RPVIRLRHAQLAE-IVDDKKQRS-IWASWVPGDPLESTCRHASLALAVVLQRRDWENP 117 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G PGK Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPGK 64 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 32.3 bits (70), Expect = 0.40 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 607 SGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 +GP G P+ ++ AVVLQRRDW P Sbjct: 20 NGPVAAGDPLESTCRHASLALAVVLQRRDWENP 52 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.3 bits (70), Expect = 0.40 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +1 Query: 619 LPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 LPG P+ ++ AVVLQRRDW P Sbjct: 28 LPGDPLESTCRHASLALAVVLQRRDWENP 56 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G PG K Sbjct: 134 GFSQSRRCKTTASAKLACLQVDSRGSPGPK 163 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.9 bits (69), Expect = 0.53 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 613 PFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 PF G P+ ++ AVVLQRRDW P Sbjct: 114 PFSTGDPLESTCRHASLALAVVLQRRDWENP 144 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.9 bits (69), Expect = 0.53 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G PG K Sbjct: 50 GFSQSRRCKTTASAKLACLQVDSRGSPGGK 79 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 31.5 bits (68), Expect = 0.70 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +1 Query: 559 MMDEHITTEENQGSNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 M H + E +G +SG + G P+ ++ AVVLQRRDW P Sbjct: 1 MRKRHASRRE-KGGQVSG--VTGDPLESTCRHASLALAVVLQRRDWENP 46 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.5 bits (68), Expect = 0.70 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +1 Query: 562 MDEH-ITTEENQGSN--LSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 +D H +TT N GS+ + G P+ ++ AVVLQRRDW P Sbjct: 36 IDPHSLTTHTNSGSSHQKAKDLKIGDPLESTCRHASLALAVVLQRRDWENP 86 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 31.5 bits (68), Expect = 0.70 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGP 609 GF QSRRCKTTA + L + G P + GP Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPLRWGP 89 >SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 31.5 bits (68), Expect = 0.70 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G PG K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPGCK 65 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 31.1 bits (67), Expect = 0.93 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +1 Query: 580 TEENQGSNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 T++++G P G P+ ++ AVVLQRRDW P Sbjct: 30 TQKSEGREFD-PHTGGDPLESTCRHASLALAVVLQRRDWENP 70 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 31.1 bits (67), Expect = 0.93 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +1 Query: 607 SGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 S PG P+ ++ AVVLQRRDW P Sbjct: 73 SSTHTPGDPLESTCRHASLALAVVLQRRDWENP 105 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 31.1 bits (67), Expect = 0.93 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP-GKKGPDRFE 597 GF QSRRCKTTA + L + G P G+ G +R + Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSGRYGNERIK 72 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 31.1 bits (67), Expect = 0.93 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +1 Query: 544 SCSETMMDEHITTE-ENQGSNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 SC ET I + +N + S PF P ++ AVVLQRRDW P Sbjct: 749 SCWETDFVISIDAKHDNMAFSRSLPFTVTVPSESTCRHASLALAVVLQRRDWENP 803 >SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 31.1 bits (67), Expect = 0.93 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 613 PFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 P L G P+ ++ AVVLQRRDW P Sbjct: 7 PLLLGDPLESTCRHASLALAVVLQRRDWENP 37 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPG 621 GF QSRRCKTTA + L + G PG Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +1 Query: 610 GPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 G L G P+ ++ AVVLQRRDW P Sbjct: 69 GDLLRGDPLESTCRHASLALAVVLQRRDWENP 100 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 622 PGYPIRPIVSRITIHWAVVLQRRDWGKP 705 PG P+ ++ AVVLQRRDW P Sbjct: 1 PGDPLESTCRHASLALAVVLQRRDWENP 28 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 622 PGYPIRPIVSRITIHWAVVLQRRDWGKP 705 PG P+ ++ AVVLQRRDW P Sbjct: 61 PGDPLESTCRHASLALAVVLQRRDWENP 88 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 622 PGYPIRPIVSRITIHWAVVLQRRDWGKP 705 PG P+ ++ AVVLQRRDW P Sbjct: 101 PGDPLESTCRHASLALAVVLQRRDWENP 128 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 622 PGYPIRPIVSRITIHWAVVLQRRDWGKP 705 PG P+ ++ AVVLQRRDW P Sbjct: 64 PGDPLESTCRHASLALAVVLQRRDWENP 91 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 601 NLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 +L G L G P+ ++ AVVLQRRDW P Sbjct: 61 SLFGADLVGDPLESTCRHASLALAVVLQRRDWENP 95 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGP 609 GF QSRRCKTTA + L + G P ++ P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPTRQPP 67 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +1 Query: 574 ITTEENQGSNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 +TT+E + G P+ ++ AVVLQRRDW P Sbjct: 23 VTTQETNARHAQMYEKDGDPLESTCRHASLALAVVLQRRDWENP 66 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 622 PGYPIRPIVSRITIHWAVVLQRRDWGKP 705 PG P+ ++ AVVLQRRDW P Sbjct: 19 PGDPLESTCRHASLALAVVLQRRDWENP 46 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 622 PGYPIRPIVSRITIHWAVVLQRRDWGKP 705 PG P+ ++ AVVLQRRDW P Sbjct: 43 PGDPLESTCRHASLALAVVLQRRDWENP 70 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPG 621 GF QSRRCKTTA + L + G PG Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPG 85 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPG 621 GF QSRRCKTTA + L + G PG Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPG 85 >SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPG 621 GF QSRRCKTTA + L + G PG Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPG 621 GF QSRRCKTTA + L + G PG Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPG 621 GF QSRRCKTTA + L + G PG Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPG 85 >SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPG 621 GF QSRRCKTTA + L + G PG Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSK 64 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSK 64 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKG 612 GF QSRRCKTTA + L + G P + G Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSQYG 66 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKG 612 GF QSRRCKTTA + L + G P G Sbjct: 163 GFSQSRRCKTTASAKLACLQVDSRGSPAANG 193 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPSK 86 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP-GKKG 612 GF QSRRCKTTA + L + G P KKG Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPKNKKG 89 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 671 PSFYNVVTGENPGV 712 PSFYNVVTG+N GV Sbjct: 9 PSFYNVVTGKNTGV 22 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 613 PFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 P+ G P+ ++ AVVLQRRDW P Sbjct: 23 PYRNGDPLESTCRHASLALAVVLQRRDWENP 53 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 671 PSFYNVVTGENPGV 712 PSFYNVVTG+N GV Sbjct: 9 PSFYNVVTGKNTGV 22 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGPDRF 600 GF QSRRCKTTA + L + G P P F Sbjct: 107 GFSQSRRCKTTASAKLACLQVDSRGSPLVSRPSHF 141 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 613 PFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 P+ G P+ ++ AVVLQRRDW P Sbjct: 31 PYPVGDPLESTCRHASLALAVVLQRRDWENP 61 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 571 HITTEENQGSNLS-GPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 H N NL+ P G P+ ++ AVVLQRRDW P Sbjct: 58 HRDDSPNPNPNLNPNPNPNGDPLESTCRHASLALAVVLQRRDWENP 103 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSTK 65 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 616 FLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 F+ G P+ ++ AVVLQRRDW P Sbjct: 117 FVVGDPLESTCRHASLALAVVLQRRDWENP 146 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPG 621 GF QSRRCKTTA +L++ ++ Y G Sbjct: 71 GFSQSRRCKTTAS---AKLSVMQVDYSG 95 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKG 612 GF QSRRCKTTA + L + G P G Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPNDMG 88 >SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P +K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPYRK 65 >SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSTK 65 >SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) Length = 122 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKG 612 GF QSRRCKTTA + L + G P + G Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPRQTG 66 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +1 Query: 571 HITTEENQGSNLSG----PFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 H+T +N+ G G P+ ++ AVVLQRRDW P Sbjct: 25 HVTIVHQNTNNVQGIAHMALTVGDPLESTCRHASLALAVVLQRRDWENP 73 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 613 PFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 P G P+ ++ AVVLQRRDW P Sbjct: 101 PLAVGDPLESTCRHASLALAVVLQRRDWENP 131 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPEK 64 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGPDRFE 597 GF QSRRCKTTA + L + G P + FE Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPVQNQRSGFE 71 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPEK 64 >SB_39468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1778 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 502 SNRDATVAFSREVISCSETMMDEHITTEENQGSNLSGPFLPGY 630 SN+D + F +S ++++ E+ T+ E S+L P P Y Sbjct: 280 SNQDTSQTFQNASLSKNQSLDQEYNTSNEEDESSLESPTNPAY 322 >SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPTK 64 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +1 Query: 559 MMDEHITTEENQG--SNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 M H + E G S+++G G P+ ++ AVVLQRRDW P Sbjct: 1 MRKRHASRREKGGQVSDVAGE--EGDPLESTCRHASLALAVVLQRRDWENP 49 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKG 612 GF QSRRCKTTA + L + G P +G Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPRIRG 88 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGP 609 GF QSRRCKTTA + L + G P + P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPRQTQP 89 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPRK 86 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P +K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPLQK 65 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P + Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSR 64 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P K Sbjct: 243 GFSQSRRCKTTASAKLACLQVDSRGSPTTK 272 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 613 PFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 P G P+ ++ AVVLQRRDW P Sbjct: 6 PTATGDPLESTCRHASLALAVVLQRRDWENP 36 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGPDRF 600 GF QSRRCKTTA + L + G P +F Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPSSYNGHQF 92 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGPDRFEP 594 GF QSRRCKTTA +L ++ G P R P Sbjct: 58 GFSQSRRCKTTAS---AKLACLQVDSRGSPCPQRLAP 91 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 619 LPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 L G P+ ++ AVVLQRRDW P Sbjct: 18 LQGDPLESTCRHASLALAVVLQRRDWENP 46 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGPDRF 600 GF QSRRCKTTA + L + G P + G F Sbjct: 331 GFSQSRRCKTTASAKLACLQVDSRGSPIQLGVQVF 365 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 619 LPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 L G P+ ++ AVVLQRRDW P Sbjct: 67 LDGDPLESTCRHASLALAVVLQRRDWENP 95 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 619 LPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 L G P+ ++ AVVLQRRDW P Sbjct: 27 LAGDPLESTCRHASLALAVVLQRRDWENP 55 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGPDRFE 597 GF QSRRCKTTA + L + G P K+G E Sbjct: 521 GFSQSRRCKTTASAKLACLQVDSRGSP-KQGKSNKE 555 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 671 PSFYNVVTGENPGV 712 PSFYNVV ENPGV Sbjct: 9 PSFYNVVHWENPGV 22 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKG 612 GF QSRRCKTTA + L + G P G Sbjct: 89 GFSQSRRCKTTASAKLACLQVDSRGSPENYG 119 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.1 bits (62), Expect = 3.7 Identities = 18/38 (47%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP--GKKGPDRFE 597 GF QSRRCKTTA + L + G P KG D E Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPEVSNKGIDTDE 73 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGPDR 603 GF QSRRCKTTA + L + G P +R Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSSARNER 69 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGP 609 GF QSRRCKTTA + L + G P + P Sbjct: 147 GFSQSRRCKTTASAKLACLQVDSRGSPFRPVP 178 >SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P + Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSR 64 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = +1 Query: 634 IRPIVSRITIHW 669 +RP+VSRITIHW Sbjct: 33 LRPVVSRITIHW 44 >SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P + Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSR 64 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +1 Query: 559 MMDEHITTEENQGSNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 M H + E G G P+ ++ AVVLQRRDW P Sbjct: 1 MRKRHASRREKGGQVSGFHRSTGDPLESTCRHASLALAVVLQRRDWENP 49 >SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P + Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPSR 64 >SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPFK 64 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P + Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPNR 86 >SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPVK 64 >SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P + Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPNR 64 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P ++ Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPKRR 87 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 604 LSGPFLP-GYPIRPIVSRITIHWAVVLQRRDWGKP 705 L+G L G P+ ++ AVVLQRRDW P Sbjct: 40 LTGELLTLGDPLESTCRHASLALAVVLQRRDWENP 74 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 595 GSNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 G L + G P+ ++ AVVLQRRDW P Sbjct: 5 GLKLEIGIMNGDPLESTCRHASLALAVVLQRRDWENP 41 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIG--YPGKKGPDRF 600 GF QSRRCKTTA + L + G +P P RF Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPFPPDDRPYRF 94 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 700 FPSHDVVKRRP 668 FPSHDVVKRRP Sbjct: 56 FPSHDVVKRRP 66 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 598 SNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 S SG G P+ ++ AVVLQRRDW P Sbjct: 13 SPYSGIVHHGDPLESTCRHASLALAVVLQRRDWENP 48 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPLK 64 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.7 bits (61), Expect = 4.9 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 7/49 (14%) Frame = +1 Query: 580 TEENQGSNLSGPFL-------PGYPIRPIVSRITIHWAVVLQRRDWGKP 705 T + NL G FL G P+ ++ AVVLQRRDW P Sbjct: 5 TNSSSVPNLKGTFLCMQQAAIRGDPLESTCRHASLALAVVLQRRDWENP 53 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P K Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPLK 86 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P K Sbjct: 68 GFSQSRRCKTTASAKLACLQVDSRGSPKVK 97 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 604 LSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 LS P+ G P+ ++ AVVLQRRDW P Sbjct: 49 LSLPY-EGDPLESTCRHASLALAVVLQRRDWENP 81 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P + Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPAQ 64 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 Query: 595 GSNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 G L G P+ ++ AVVLQRRDW P Sbjct: 31 GQRLDVVVAQGDPLESTCRHASLALAVVLQRRDWENP 67 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P ++ Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPDEQ 65 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +1 Query: 646 VSRITIHWAVVLQRRDW 696 +SRIT AVVLQRRDW Sbjct: 88 LSRITNSLAVVLQRRDW 104 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 619 LPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 L G P+ ++ AVVLQRRDW P Sbjct: 21 LRGDPLESTCRHASLALAVVLQRRDWENP 49 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 586 ENQGSNLSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 +N+G P G P+ ++ AVVLQRRDW P Sbjct: 64 DNKGRRF--PNKAGDPLESTCRHASLALAVVLQRRDWENP 101 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKG 612 GF QSRRCKTTA + L + G P G Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPLSAG 66 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGK 618 GF QSRRCKTTA + L + G P + Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPDR 64 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGP 609 GF QSRRCKTTA + L + G P +GP Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP--QGP 65 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGP 609 GF QSRRCKTTA + L + G P P Sbjct: 29 GFSQSRRCKTTASAKLACLQVDSRGSPAVPYP 60 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGPDR 603 GF QSRRCKTTA + L + G P P R Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPMTIPPAR 69 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P K Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPYAK 87 >SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) Length = 444 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 700 FPSHDVVKRRP 668 FPSHDVVKRRP Sbjct: 218 FPSHDVVKRRP 228 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P ++ Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSPFRR 87 >SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 604 LSGPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 LS G P+ ++ AVVLQRRDW P Sbjct: 20 LSKELQSGDPLESTCRHASLALAVVLQRRDWENP 53 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 Query: 671 PSFYNVVTGENPG 709 PSFYNVVTG+N G Sbjct: 9 PSFYNVVTGKNTG 21 >SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKK 615 GF QSRRCKTTA + L + G P K Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSPFAK 65 >SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYPGKKGP 609 GF QSRRCKTTA + L + G P P Sbjct: 17 GFSQSRRCKTTASAKLACLQVDSRGSPPPFSP 48 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 181 GFSQSRRCKTTASAKLACLQVDSRGSP 207 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 402 GFSQSRRCKTTASAKLACLQVDSRGSP 428 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 610 GPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 G G P+ ++ AVVLQRRDW P Sbjct: 18 GVIRDGDPLESTCRHASLALAVVLQRRDWENP 49 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 104 GFSQSRRCKTTASAKLACLQVDSRGSP 130 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 685 GFSQSRRCKTTASAKLACLQVDSRGSP 711 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 191 GFSQSRRCKTTASAKLACLQVDSRGSP 217 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 610 GPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 G G P+ ++ AVVLQRRDW P Sbjct: 13 GQVSAGDPLESTCRHASLALAVVLQRRDWENP 44 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 610 GPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 G + G P+ ++ AVVLQRRDW P Sbjct: 12 GGQVSGDPLESTCRHASLALAVVLQRRDWENP 43 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 613 PFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 P G P+ ++ AVVLQRRDW P Sbjct: 25 PLNLGDPLESTCRHASLALAVVLQRRDWENP 55 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 594 GFSQSRRCKTTASAKLACLQVDSRGSP 620 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = +1 Query: 538 VISCSETMMDEHITTEENQGSNLSGPFLP----GYPIRPIVSRITIHWAVVLQRRDWGKP 705 V+S +++ + E++ ++ P G P+ ++ AVVLQRRDW P Sbjct: 1016 VVSSTQSNLSEYVPDAYEPCKLITSDVKPLPSGGDPLESTCRHASLALAVVLQRRDWENP 1075 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 619 LPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 + G P+ ++ AVVLQRRDW P Sbjct: 1 MTGDPLESTCRHASLALAVVLQRRDWENP 29 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 610 GPFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 G + G P+ ++ AVVLQRRDW P Sbjct: 12 GGQVSGDPLESTCRHASLALAVVLQRRDWENP 43 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 574 ITTEENQGSNLSGPFLP-GYPIRPIVSRITIHWAVVLQRRDWGKP 705 + E+ + + F P G P+ ++ AVVLQRRDW P Sbjct: 138 LAAEKTKARSTHDCFDPAGDPLESTCRHASLALAVVLQRRDWENP 182 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 824 GFSQSRRCKTTASAKLACLQVDSRGSP 850 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIG 639 GF QSRRCKTTA + L +G Sbjct: 485 GFSQSRRCKTTASAKLACLQVG 506 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 104 GFSQSRRCKTTASAKLACLQVDSRGSP 130 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 50 GFSQSRRCKTTASAKLACLQVDSRGSP 76 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 1140 GFSQSRRCKTTASAKLACLQVDSRGSP 1166 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 145 GFSQSRRCKTTASAKLACLQVDSRGSP 171 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 55 GFSQSRRCKTTASAKLACLQVDSRGSP 81 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 17 GFSQSRRCKTTASAKLACLQVDSRGSP 43 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 29 GFSQSRRCKTTASAKLACLQVDSRGSP 55 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 50 GFSQSRRCKTTASAKLACLQVDSRGSP 76 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 616 FLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 F G P+ ++ AVVLQRRDW P Sbjct: 3 FRYGDPLESTCRHASLALAVVLQRRDWENP 32 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 129 GFSQSRRCKTTASAKLACLQVDSRGSP 155 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_9479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 625 GYPIRPIVSRITIHWAVVLQRRDWGKP 705 G P+ ++ AVVLQRRDW P Sbjct: 9 GNPLESTCRHASLALAVVLQRRDWQNP 35 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 91 GFSQSRRCKTTASAKLACLQVDSRGSP 117 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 613 PFLPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 P G P+ ++ AVVLQRRDW P Sbjct: 8 PTPAGDPLESTCRHASLALAVVLQRRDWENP 38 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 85 GFSQSRRCKTTASAKLACLQVDSRGSP 111 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 190 GFSQSRRCKTTASAKLACLQVDSRGSP 216 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_57479| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 939 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 385 VESGFVELHHIPWDFVVTLYWSQPCSRLLSYTSG 284 V+ F+ELHH P DF V+ ++ L+Y G Sbjct: 647 VDKNFIELHHNPKDF-VSFQYALASDETLNYVIG 679 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 50 GFSQSRRCKTTASAKLACLQVDSRGSP 76 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 619 LPGYPIRPIVSRITIHWAVVLQRRDWGKP 705 L G P+ ++ AVVLQRRDW P Sbjct: 77 LLGDPLESTCRHASLALAVVLQRRDWENP 105 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 36 GFSQSRRCKTTASAKLACLQVDSRGSP 62 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 227 GFSQSRRCKTTASAKLACLQVDSRGSP 253 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 704 GFPQSRRCKTTAQ*IVIRLTIGRIGYP 624 GF QSRRCKTTA + L + G P Sbjct: 58 GFSQSRRCKTTASAKLACLQVDSRGSP 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,761,672 Number of Sequences: 59808 Number of extensions: 525113 Number of successful extensions: 4038 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4034 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -