BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0254 (714 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.71 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 2.2 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 6.6 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 6.6 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.0 bits (52), Expect = 0.71 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +1 Query: 205 KCQSRTHNYVVCFLVA*FIELYRYANRRWCSSAGASMADSSTVLQQNPMGCDEAQQSRIQ 384 KC R N +E Y+ +R CS+ G + S T L +P +A + +Q Sbjct: 560 KCFMRVENVKGAVWTVDEVEFYKRRPQRACSTTGGVPSKSPT-LTHSPTMYGDALNANLQ 618 Query: 385 RA 390 A Sbjct: 619 AA 620 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -2 Query: 212 WHFNSRRPPRP*KQIFFA 159 WH N P P QIFFA Sbjct: 407 WHSNLTTPDDPDIQIFFA 424 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 6.6 Identities = 6/23 (26%), Positives = 13/23 (56%) Frame = +2 Query: 557 R*WMNTLPPRKIKVQIYRGLFYP 625 R W++ P R ++ + +F+P Sbjct: 402 RSWLSKFPTRSKRIDVISRIFFP 424 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 6.6 Identities = 6/23 (26%), Positives = 13/23 (56%) Frame = +2 Query: 557 R*WMNTLPPRKIKVQIYRGLFYP 625 R W++ P R ++ + +F+P Sbjct: 402 RSWLSKFPTRSKRIDVISRIFFP 424 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,703 Number of Sequences: 438 Number of extensions: 4955 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -