BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0253 (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52855| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_43299| Best HMM Match : MTS (HMM E-Value=3.8e-06) 28 5.9 >SB_52855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 4/43 (9%) Frame = +2 Query: 449 NFSIKSNIN----I*GILTYKLVQIIIILLSYKQSHQTNVFSP 565 N SIK+NIN + I+ +V I+I LSY H T V SP Sbjct: 16 NTSIKNNINFYHIVSNIIIAIIVTIVISPLSYHHRHTTIVISP 58 >SB_43299| Best HMM Match : MTS (HMM E-Value=3.8e-06) Length = 250 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/46 (28%), Positives = 28/46 (60%) Frame = +2 Query: 341 IQTSSRPRTTVTTHHQKGSVLTIMFLVQSSYGRWRWNFSIKSNINI 478 ++ SS+ + VT + Q+G V++ S +G W++NF +K +++ Sbjct: 16 MRISSQTKKRVTIN-QRGYVVSPTVFDGSVFGEWKYNFFVKELVSM 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,173,335 Number of Sequences: 59808 Number of extensions: 361761 Number of successful extensions: 742 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 741 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -