BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0253 (663 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z54218-4|CAA90958.1| 1367|Caenorhabditis elegans Hypothetical pr... 28 6.8 Z49910-9|CAA90125.1| 1367|Caenorhabditis elegans Hypothetical pr... 28 6.8 AC006830-8|ABA00186.1| 289|Caenorhabditis elegans Hypothetical ... 28 6.8 >Z54218-4|CAA90958.1| 1367|Caenorhabditis elegans Hypothetical protein F44G4.8 protein. Length = 1367 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 265 YRKTLCWCNNYGVIKINRYNEMVRLNSDIKPSTNNSNHSPSEGQCAHYNVFST 423 YR L G+I R+NE +R++S P+ N S S + VFST Sbjct: 504 YRVQLFTVTKTGIISETRHNETIRMSS---PAVNVSLESVTRSSATLRIVFST 553 >Z49910-9|CAA90125.1| 1367|Caenorhabditis elegans Hypothetical protein F44G4.8 protein. Length = 1367 Score = 27.9 bits (59), Expect = 6.8 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 265 YRKTLCWCNNYGVIKINRYNEMVRLNSDIKPSTNNSNHSPSEGQCAHYNVFST 423 YR L G+I R+NE +R++S P+ N S S + VFST Sbjct: 504 YRVQLFTVTKTGIISETRHNETIRMSS---PAVNVSLESVTRSSATLRIVFST 553 >AC006830-8|ABA00186.1| 289|Caenorhabditis elegans Hypothetical protein ZK105.8 protein. Length = 289 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +2 Query: 431 YGRWRWNFSIKSNINI*GILTYKLVQIIIILLSYKQSHQT 550 Y +W FSI+++ I IL+ ++QI +L S+ + HQ+ Sbjct: 62 YSKW---FSIRTHFQINMILSLIVLQICSLLCSFMRKHQS 98 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,939,880 Number of Sequences: 27780 Number of extensions: 287711 Number of successful extensions: 621 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 621 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -