BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0251 (570 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9U3D2 Cluster: Putative uncharacterized protein; n=1; ... 32 8.2 >UniRef50_Q9U3D2 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 516 Score = 32.3 bits (70), Expect = 8.2 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 5/67 (7%) Frame = -3 Query: 379 TSVCMLLIFKSIIDNSKNGVTQ----NRIISKGNNNE-SGFSFL*FVVYKHVTIYLHFLC 215 T++C +L+F S D S+N + ++S G E S F+ L F+ YK +Y FLC Sbjct: 77 TNICGILVFNSKTDLSENEIVNLFMPVLVLSGGMRVENSSFTSLGFLSYK--GLYFRFLC 134 Query: 214 NENQILI 194 + + ++I Sbjct: 135 DRHGMVI 141 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,301,578 Number of Sequences: 1657284 Number of extensions: 9453221 Number of successful extensions: 18871 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18864 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 38738010471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -