BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0251 (570 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 24 3.0 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 23 7.0 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 24.2 bits (50), Expect = 3.0 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 296 LGDNAILGYAILRVVNYTFKYQ*HTN 373 +G N + G++ + + N KY H+N Sbjct: 113 IGQNLVRGFSFIIIANILQKYDVHSN 138 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.0 bits (47), Expect = 7.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 300 PRVTIMKAVFHFYNLSFTNM*QFISIFCVMKTK 202 P + + +AV LSF N+ I+ V+KTK Sbjct: 340 PLLALFEAVRPHLQLSFENILAHINTIYVLKTK 372 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 544,227 Number of Sequences: 2352 Number of extensions: 10184 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -