BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0251 (570 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D29767-1|BAA06171.1| 631|Homo sapiens Tec protein-tyrosine kina... 29 8.7 BC101713-1|AAI01714.1| 631|Homo sapiens tec protein tyrosine ki... 29 8.7 BC101711-1|AAI01712.1| 631|Homo sapiens tec protein tyrosine ki... 29 8.7 >D29767-1|BAA06171.1| 631|Homo sapiens Tec protein-tyrosine kinase protein. Length = 631 Score = 29.5 bits (63), Expect = 8.7 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 105 IDTRKI*CVPNVKNSDSTVVCYIK--FQVKH 19 ID KI CV VKN D + C K FQV H Sbjct: 54 IDVSKIKCVEIVKNDDGVIPCQNKYPFQVVH 84 >BC101713-1|AAI01714.1| 631|Homo sapiens tec protein tyrosine kinase protein. Length = 631 Score = 29.5 bits (63), Expect = 8.7 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 105 IDTRKI*CVPNVKNSDSTVVCYIK--FQVKH 19 ID KI CV VKN D + C K FQV H Sbjct: 54 IDVSKIKCVEIVKNDDGVIPCQNKYPFQVVH 84 >BC101711-1|AAI01712.1| 631|Homo sapiens tec protein tyrosine kinase protein. Length = 631 Score = 29.5 bits (63), Expect = 8.7 Identities = 16/31 (51%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 105 IDTRKI*CVPNVKNSDSTVVCYIK--FQVKH 19 ID KI CV VKN D + C K FQV H Sbjct: 54 IDVSKIKCVEIVKNDDGVIPCQNKYPFQVVH 84 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,384,064 Number of Sequences: 237096 Number of extensions: 1282810 Number of successful extensions: 1672 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1672 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5816287018 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -