BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0250 (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit ... 27 2.0 SPBC409.12c |||nuclear telomere cap complex subunit Stn1|Schizos... 25 8.2 >SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit Bdp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 507 Score = 27.5 bits (58), Expect = 2.0 Identities = 12/52 (23%), Positives = 28/52 (53%) Frame = -1 Query: 698 TERSQNHHPILAQPTMSKVDRVHASLKISSVHRSGDHFRTPRCYFILNQSVM 543 T+ S + L+ PT S +D++ +++ ++ + ++ TPR + Q V+ Sbjct: 271 TDESASLEDSLSHPTKSILDQLADKMEVDGLNNNSNYSATPRTRVVNGQIVL 322 >SPBC409.12c |||nuclear telomere cap complex subunit Stn1|Schizosaccharomyces pombe|chr 2|||Manual Length = 325 Score = 25.4 bits (53), Expect = 8.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 716 KIKYPITERSQNHHPILAQPTMSKVDRVHA 627 + K +T+ S+NHH I+ P S + HA Sbjct: 141 RYKKNLTKISKNHHSIIRTPKKSYFPKDHA 170 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,698,852 Number of Sequences: 5004 Number of extensions: 51204 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -