BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0249 (667 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 25 0.42 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 6.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 6.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 6.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 6.9 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 25.4 bits (53), Expect = 0.42 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 438 MKIRFCIFIHSRRINRCNFSQF 503 M R CI I S R N NFS+F Sbjct: 1 MSTRICIPISSGRTNGSNFSKF 22 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.9 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +3 Query: 435 FMKIRFCIFIHSRRINRCNFSQFFYDITLHDTYYVVAHFHYVL 563 F R C F S++ +F F+ TLH T + Y+L Sbjct: 148 FRSSRMCFFKSSKKPAFSHFLIVFFTETLH-TVGIALLIFYIL 189 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.9 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +3 Query: 435 FMKIRFCIFIHSRRINRCNFSQFFYDITLHDTYYVVAHFHYVL 563 F R C F S++ +F F+ TLH T + Y+L Sbjct: 148 FRSSRMCFFKSSKKPAFSHFLIVFFTETLH-TVGIALLIFYIL 189 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.9 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +3 Query: 435 FMKIRFCIFIHSRRINRCNFSQFFYDITLHDTYYVVAHFHYVL 563 F R C F S++ +F F+ TLH T + Y+L Sbjct: 148 FRSSRMCFFKSSKKPAFSHFLIVFFTETLH-TVGIALLIFYIL 189 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 6.9 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +3 Query: 435 FMKIRFCIFIHSRRINRCNFSQFFYDITLHDTYYVVAHFHYVL 563 F R C F S++ +F F+ TLH T + Y+L Sbjct: 148 FRSSRMCFFKSSKKPAFSHFLIVFFTETLH-TVGIALLIFYIL 189 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,789 Number of Sequences: 336 Number of extensions: 2386 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -