BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0247 (689 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27952| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_28102| Best HMM Match : YTH (HMM E-Value=0) 28 8.2 >SB_27952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/44 (31%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -1 Query: 269 SRSPVIHNEKCVQTRKTRAQIKDVADSEIKSYNKTFK--FIRLH 144 +R PV+H +Q +K DS I+SY + F R+H Sbjct: 46 ARGPVLHKNSTIQRAVPGVTVKADLDSRIQSYATCLRHVFFRIH 89 >SB_28102| Best HMM Match : YTH (HMM E-Value=0) Length = 325 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -1 Query: 479 GKSIVIVSRVSKFAFRSSVKYLEWMYTNHGS*KFNSYF 366 G I+ S+ S+KY W T HG+ + N F Sbjct: 159 GARFFIIKSYSEDDIHRSIKYCVWTSTEHGNRRLNEAF 196 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,562,466 Number of Sequences: 59808 Number of extensions: 412272 Number of successful extensions: 752 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -