BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0245 (695 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825684-1|AAV70247.1| 166|Anopheles gambiae olfactory receptor... 25 2.3 AY825683-1|AAV70246.1| 166|Anopheles gambiae olfactory receptor... 25 2.3 AY825680-1|AAV70243.1| 158|Anopheles gambiae olfactory receptor... 25 2.3 AY825679-1|AAV70242.1| 158|Anopheles gambiae olfactory receptor... 25 2.3 AY825678-1|AAV70241.1| 167|Anopheles gambiae olfactory receptor... 25 2.3 AY825677-1|AAV70240.1| 167|Anopheles gambiae olfactory receptor... 25 2.3 AY825665-1|AAV70228.1| 166|Anopheles gambiae olfactory receptor... 25 2.3 AY825653-1|AAV70216.1| 167|Anopheles gambiae olfactory receptor... 25 2.3 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 25 3.0 AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor... 24 4.0 AY825681-1|AAV70244.1| 165|Anopheles gambiae olfactory receptor... 24 4.0 AY825676-1|AAV70239.1| 166|Anopheles gambiae olfactory receptor... 24 4.0 AY825675-1|AAV70238.1| 166|Anopheles gambiae olfactory receptor... 24 4.0 AY825674-1|AAV70237.1| 168|Anopheles gambiae olfactory receptor... 24 4.0 AY825673-1|AAV70236.1| 168|Anopheles gambiae olfactory receptor... 24 4.0 AY825671-1|AAV70234.1| 166|Anopheles gambiae olfactory receptor... 24 4.0 AY825670-1|AAV70233.1| 165|Anopheles gambiae olfactory receptor... 24 4.0 AY825669-1|AAV70232.1| 165|Anopheles gambiae olfactory receptor... 24 4.0 AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor... 24 4.0 AY825667-1|AAV70230.1| 168|Anopheles gambiae olfactory receptor... 24 4.0 AY825666-1|AAV70229.1| 166|Anopheles gambiae olfactory receptor... 24 4.0 AY825664-1|AAV70227.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825663-1|AAV70226.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825662-1|AAV70225.1| 166|Anopheles gambiae olfactory receptor... 24 4.0 AY825661-1|AAV70224.1| 166|Anopheles gambiae olfactory receptor... 24 4.0 AY825660-1|AAV70223.1| 163|Anopheles gambiae olfactory receptor... 24 4.0 AY825659-1|AAV70222.1| 163|Anopheles gambiae olfactory receptor... 24 4.0 AY825658-1|AAV70221.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825657-1|AAV70220.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825656-1|AAV70219.1| 152|Anopheles gambiae olfactory receptor... 24 4.0 AY825655-1|AAV70218.1| 152|Anopheles gambiae olfactory receptor... 24 4.0 AY825654-1|AAV70217.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825652-1|AAV70215.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825651-1|AAV70214.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825650-1|AAV70213.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825649-1|AAV70212.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825648-1|AAV70211.1| 169|Anopheles gambiae olfactory receptor... 24 4.0 AY825647-1|AAV70210.1| 169|Anopheles gambiae olfactory receptor... 24 4.0 AY825646-1|AAV70209.1| 168|Anopheles gambiae olfactory receptor... 24 4.0 AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor... 24 4.0 AY825644-1|AAV70207.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor... 24 4.0 AY825642-1|AAV70205.1| 161|Anopheles gambiae olfactory receptor... 24 4.0 AY825641-1|AAV70204.1| 161|Anopheles gambiae olfactory receptor... 24 4.0 U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. 23 7.0 >AY825684-1|AAV70247.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL-IKTN 8 T V+ + ++HL LE L DPL +K N Sbjct: 127 TMVKADIFIIHLGELEKMLNDPLTVKKN 154 >AY825683-1|AAV70246.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL-IKTN 8 T V+ + ++HL LE L DPL +K N Sbjct: 127 TMVKADIFIIHLGELEKMLNDPLTVKKN 154 >AY825680-1|AAV70243.1| 158|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 158 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL-IKTN 8 T V+ + ++HL LE L DPL +K N Sbjct: 119 TMVKADIFIIHLGELEKMLNDPLTVKKN 146 >AY825679-1|AAV70242.1| 158|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 158 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL-IKTN 8 T V+ + ++HL LE L DPL +K N Sbjct: 119 TMVKADIFIIHLGELEKMLNDPLTVKKN 146 >AY825678-1|AAV70241.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL-IKTN 8 T V+ + ++HL LE L DPL +K N Sbjct: 127 TMVKADIFIIHLGELEKMLNDPLTVKKN 154 >AY825677-1|AAV70240.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL-IKTN 8 T V+ + ++HL LE L DPL +K N Sbjct: 127 TMVKADIFIIHLGELEKMLNDPLTVKKN 154 >AY825665-1|AAV70228.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL-IKTN 8 T V+ + ++HL LE L DPL +K N Sbjct: 127 TMVKADIFIIHLGELEKMLNDPLTVKKN 154 >AY825653-1|AAV70216.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 25.0 bits (52), Expect = 2.3 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL-IKTN 8 T V+ + ++HL LE L DPL +K N Sbjct: 127 TMVKADIFIIHLGELEKMLNDPLTVKKN 154 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 Query: 310 KPLRRPKGSKSINNKYIVNSFCA*NAH 230 K R+PK + NN Y N +C +H Sbjct: 148 KKKRKPKPPRIYNNNYYYNYYCRNISH 174 >AY825682-1|AAV70245.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 125 TMVKADIFIIHLDELEKMLNDPL 147 >AY825681-1|AAV70244.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 125 TMVKADIFIIHLGELEKMLNDPL 147 >AY825676-1|AAV70239.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825675-1|AAV70238.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825674-1|AAV70237.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825673-1|AAV70236.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825671-1|AAV70234.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825670-1|AAV70233.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 125 TMVKADIFIIHLGELEKMLNDPL 147 >AY825669-1|AAV70232.1| 165|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 165 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 125 TMVKADIFIIHLGELEKMLNDPL 147 >AY825668-1|AAV70231.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLDELEKMLNDPL 150 >AY825667-1|AAV70230.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825666-1|AAV70229.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825664-1|AAV70227.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825663-1|AAV70226.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825662-1|AAV70225.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825661-1|AAV70224.1| 166|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 166 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825660-1|AAV70223.1| 163|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 163 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 124 TMVKADIFIIHLGELEKMLNDPL 146 >AY825659-1|AAV70222.1| 163|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 163 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 124 TMVKADIFIIHLGELEKMLNDPL 146 >AY825658-1|AAV70221.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825657-1|AAV70220.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825656-1|AAV70219.1| 152|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 152 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 116 TMVKADIFIIHLGELEKMLNDPL 138 >AY825655-1|AAV70218.1| 152|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 152 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 116 TMVKADIFIIHLGELEKMLNDPL 138 >AY825654-1|AAV70217.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825652-1|AAV70215.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825651-1|AAV70214.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825650-1|AAV70213.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825649-1|AAV70212.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 127 TMVKADIFIIHLGELEKMLNDPL 149 >AY825648-1|AAV70211.1| 169|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 169 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 130 TMVKADIFIIHLGELEKMLNDPL 152 >AY825647-1|AAV70210.1| 169|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 169 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 130 TMVKADIFIIHLGELEKMLNDPL 152 >AY825646-1|AAV70209.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825644-1|AAV70207.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825643-1|AAV70206.1| 167|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 128 TMVKADIFIIHLGELEKMLNDPL 150 >AY825642-1|AAV70205.1| 161|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 161 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 122 TMVKADIFIIHLGELEKMLNDPL 144 >AY825641-1|AAV70204.1| 161|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 161 Score = 24.2 bits (50), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 88 TQVRIEPLLLHLMTLEPFLKDPL 20 T V+ + ++HL LE L DPL Sbjct: 122 TMVKADIFIIHLGELEKMLNDPL 144 >U28809-1|AAC47326.1| 140|Anopheles gambiae lysozyme protein. Length = 140 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 377 VIFTLIRAIVVVSTIAVGKCYAPHELSPLLPFGG 478 V FT++ AIV +A K + EL+ L G Sbjct: 3 VFFTVLLAIVACCAVAEAKTFGKCELAKALANNG 36 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,565 Number of Sequences: 2352 Number of extensions: 15206 Number of successful extensions: 63 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -