BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0243 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 25 1.6 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 2.2 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 132 SHYVRFRIYSRTNHTNSYSFCFNTC 58 S+ VR +IY T HTN + C Sbjct: 389 SYIVRVKIYLETEHTNMNIYLVQNC 413 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.0 bits (52), Expect = 2.2 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -1 Query: 206 SENGNGMTSNPISISKPRGRVQGERATMLGLEFILEQITQI 84 + G G T+ P+S S+P R + A+ G+ E+ T + Sbjct: 1050 TNGGGGSTAAPLSDSRPVSRSASDEASKDGMVASKEERTDV 1090 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 695,833 Number of Sequences: 2352 Number of extensions: 15720 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -