BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0240 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 pr... 71 3e-14 AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 pr... 70 8e-14 AY748840-1|AAV28188.1| 104|Anopheles gambiae cytochrome P450 pr... 62 1e-11 AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 pr... 62 2e-11 AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 pr... 57 6e-10 AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CY... 54 5e-09 AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CY... 52 1e-08 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 52 2e-08 AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CY... 51 4e-08 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 51 4e-08 AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 50 7e-08 AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 pr... 50 7e-08 AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CY... 50 7e-08 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 50 9e-08 AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CY... 49 1e-07 AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CY... 49 1e-07 AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CY... 48 2e-07 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 48 4e-07 AY062203-1|AAL58564.1| 149|Anopheles gambiae cytochrome P450 CY... 47 5e-07 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 47 6e-07 AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CY... 47 6e-07 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 46 8e-07 AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CY... 46 1e-06 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 46 1e-06 AY748830-1|AAV28178.1| 95|Anopheles gambiae cytochrome P450 pr... 46 1e-06 AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 pr... 46 1e-06 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 46 1e-06 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 45 2e-06 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 45 2e-06 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 45 2e-06 AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 pr... 44 4e-06 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 44 4e-06 AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 pr... 44 6e-06 AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CY... 44 6e-06 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 44 6e-06 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 43 8e-06 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 43 8e-06 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 43 8e-06 AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CY... 43 8e-06 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 43 1e-05 DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 42 2e-05 AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 pr... 42 2e-05 DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. 42 2e-05 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 42 2e-05 AY745219-1|AAU93486.1| 104|Anopheles gambiae cytochrome P450 pr... 41 3e-05 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 41 3e-05 AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 41 4e-05 AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CY... 41 4e-05 AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CY... 41 4e-05 AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 pr... 40 7e-05 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 40 9e-05 AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 pr... 39 1e-04 AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 pr... 39 1e-04 AY745225-1|AAU93492.1| 156|Anopheles gambiae cytochrome P450 pr... 39 1e-04 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 39 1e-04 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 39 2e-04 AY745207-1|AAU93474.1| 103|Anopheles gambiae cytochrome P450 pr... 38 4e-04 AY745206-1|AAU93473.1| 91|Anopheles gambiae cytochrome P450 pr... 36 9e-04 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 36 0.001 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 35 0.002 AY748846-1|AAV28192.1| 147|Anopheles gambiae cytochrome P450 pr... 35 0.003 AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CY... 35 0.003 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 35 0.003 AY745223-1|AAU93490.1| 83|Anopheles gambiae cytochrome P450 pr... 33 0.006 AY062195-1|AAL58556.1| 139|Anopheles gambiae cytochrome P450 CY... 31 0.025 AY748847-1|AAV28193.1| 104|Anopheles gambiae cytochrome P450 pr... 31 0.033 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 31 0.033 AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 pr... 31 0.044 AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 pr... 31 0.044 AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CY... 31 0.044 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 30 0.058 AY745210-1|AAU93477.1| 86|Anopheles gambiae cytochrome P450 pr... 29 0.18 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 27 0.41 AY745216-1|AAU93483.1| 89|Anopheles gambiae cytochrome P450 pr... 26 0.94 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 5.0 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 23 6.6 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 6.6 >AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 protein. Length = 155 Score = 70.9 bits (166), Expect = 3e-14 Identities = 30/78 (38%), Positives = 48/78 (61%) Frame = +3 Query: 267 GIPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQE 446 GIPH ++D L Y IPK+ M++ + + +D N+WE P +F P RFL +DG + P + Sbjct: 52 GIPHRALKDTTLCGYHIPKDTMLVGMFRGMMLDENLWENPTQFNPERFL-KDGKIHIPAQ 110 Query: 447 FIPFQTGKRMCPGDELSR 500 + PF GK C G+ +++ Sbjct: 111 YHPFGVGKHRCMGELMAK 128 >AY748839-1|AAV28187.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 69.7 bits (163), Expect = 8e-14 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 1/83 (1%) Frame = +3 Query: 255 IVPVGIPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLL 434 +VP GI H ED L Y +PK+ +V+ AIH W +PE+F+P RFL + G L Sbjct: 67 LVPSGIAHRVQEDTTLRGYDLPKDTLVLIGLDAIHNQREYWGDPERFRPERFLDEHGRLA 126 Query: 435 KPQEF-IPFQTGKRMCPGDELSR 500 ++ +PF GKR+C G+ +R Sbjct: 127 LAKDLSVPFGAGKRLCAGETFAR 149 >AY748840-1|AAV28188.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 62.5 bits (145), Expect = 1e-11 Identities = 31/82 (37%), Positives = 45/82 (54%), Gaps = 4/82 (4%) Frame = +3 Query: 255 IVPVGIPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGS-- 428 +VP GIPH D L ++IPK ++I I+ +V+ EP F+P RFL+ DG Sbjct: 22 LVPSGIPHVATADTELAGFQIPKGTLIINGLDYINHQEDVFPEPHTFRPERFLSDDGQQQ 81 Query: 429 --LLKPQEFIPFQTGKRMCPGD 488 L+ +PF GKR+C G+ Sbjct: 82 QLALEHDRSVPFGAGKRVCAGE 103 >AY745208-1|AAU93475.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 62.1 bits (144), Expect = 2e-11 Identities = 33/87 (37%), Positives = 45/87 (51%), Gaps = 5/87 (5%) Frame = +3 Query: 255 IVPVGIPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSL- 431 IVPV P + D LG YR+PK+ V+ +HMD + W +PE F+P RFL + Sbjct: 12 IVPVSGPRRTLADCSLGGYRVPKDTTVLIGLRTVHMDRDYWGDPEVFRPERFLESERDTA 71 Query: 432 ----LKPQEFIPFQTGKRMCPGDELSR 500 L + F GKR C G+ L+R Sbjct: 72 GKPHLHTDRLMFFGIGKRRCLGEVLAR 98 >AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 protein. Length = 158 Score = 56.8 bits (131), Expect = 6e-10 Identities = 22/57 (38%), Positives = 37/57 (64%) Frame = +3 Query: 270 IPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKP 440 +PH +D+ +G Y + K+ ++ + + M P +W+EPE+F+P RFL Q G L+KP Sbjct: 101 VPHVANQDSQIGGYTVAKDTLIFLNNYDLSMSPALWDEPERFRPERFL-QQGRLVKP 156 >AY062197-1|AAL58558.1| 150|Anopheles gambiae cytochrome P450 CYP4C27 protein. Length = 150 Score = 53.6 bits (123), Expect = 5e-09 Identities = 24/66 (36%), Positives = 35/66 (53%) Frame = +3 Query: 288 EDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTG 467 ED LG +++P +V + +H D + +PEKF P RFL ++ P +IPF G Sbjct: 84 EDVQLGGHQVPAQTIVGIHAYHVHRDERFYPDPEKFDPDRFLPENTENRHPYAYIPFTAG 143 Query: 468 KRMCPG 485 R C G Sbjct: 144 PRNCIG 149 Score = 32.3 bits (70), Expect = 0.014 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +1 Query: 76 GLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 G DTT+ ++W L +AL P+ QE + +EI Sbjct: 9 GHDTTTAGISWVLFLLALHPDVQERVCEEI 38 >AY062205-1|AAL58566.1| 154|Anopheles gambiae cytochrome P450 CYP4C26 protein. Length = 154 Score = 52.4 bits (120), Expect = 1e-08 Identities = 26/81 (32%), Positives = 39/81 (48%) Frame = +3 Query: 258 VPVGIPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLK 437 +PV I ED + NY IP + + + +H D +V+ P+KF P FL ++ Sbjct: 75 IPV-IGRRLTEDVRVDNYTIPAGTTAMIVVYELHRDTSVFSNPDKFNPDNFLPENCHGRH 133 Query: 438 PQEFIPFQTGKRMCPGDELSR 500 P +IPF G R C G + Sbjct: 134 PYAYIPFTAGPRNCIGQSTGK 154 Score = 29.9 bits (64), Expect = 0.076 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 76 GLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 G DTT+ +AW L + P+ QE + +EI Sbjct: 9 GHDTTAAAMAWILYLLGAAPDIQERVIQEI 38 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 52.0 bits (119), Expect = 2e-08 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +3 Query: 315 IPKNAMV-IPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 IPK+ + IP+ +A+H DP + EP++F P RFL ++ P F+PF G R+C G Sbjct: 397 IPKDTFIQIPV-YALHRDPEFYPEPDQFNPDRFLPEEVKKRHPYVFLPFGEGPRICIG 453 >AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CYP4C28 protein. Length = 150 Score = 50.8 bits (116), Expect = 4e-08 Identities = 21/59 (35%), Positives = 31/59 (52%) Frame = +3 Query: 309 YRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 + IP + + + +H DP + PEKF P RFL ++ + P +IPF G R C G Sbjct: 91 HHIPSGTNAVIMLYQLHRDPQYFPNPEKFYPDRFLPENSTNRHPYSYIPFTAGPRNCIG 149 Score = 26.2 bits (55), Expect = 0.94 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 76 GLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 G DTT++ LAW L + QE + EI Sbjct: 9 GHDTTAIALAWMLYLLGTDQTVQERVFLEI 38 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 50.8 bits (116), Expect = 4e-08 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = +3 Query: 315 IPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 IPK +V +AI DP+ + +PE+F P RFL ++ P FIPF G R+C G Sbjct: 400 IPKRTLVQIPAYAIQRDPDHYPDPERFNPDRFLPEEVKKRHPFTFIPFGEGPRICIG 456 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 50.0 bits (114), Expect = 7e-08 Identities = 23/70 (32%), Positives = 35/70 (50%) Frame = +3 Query: 288 EDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTG 467 +D + I K +V IH DP + EPE+F P RF A + + ++P ++PF G Sbjct: 35 DDGQGTRFTIEKGTLVFIPVVGIHFDPKYFPEPERFDPERFSAANRNNIQPGTYLPFGAG 94 Query: 468 KRMCPGDELS 497 R C G + Sbjct: 95 PRNCIGSRFA 104 >AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 50.0 bits (114), Expect = 7e-08 Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +3 Query: 315 IPKNAMV-IPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 +PK+ +V IP+ +AI DP+ + +PE+F P RFL ++ P F+PF G R+C G Sbjct: 23 VPKDTVVQIPI-YAIQRDPDHYPDPERFDPDRFLPEEVKKRHPYVFLPFGEGPRICIG 79 >AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CYP4H14 protein. Length = 151 Score = 50.0 bits (114), Expect = 7e-08 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +3 Query: 261 PVGI-PHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLK 437 PVGI +ED L +P V+ + IH +P ++ P +F P RF S Sbjct: 75 PVGIIGRALVEDLELNGTTVPAGQNVLVPIYVIHRNPEIYPNPNQFDPSRFAEDAESKRG 134 Query: 438 PQEFIPFQTGKRMCPG 485 P +++PF G R C G Sbjct: 135 PFDYLPFSAGPRNCIG 150 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 49.6 bits (113), Expect = 9e-08 Identities = 22/57 (38%), Positives = 31/57 (54%) Frame = +3 Query: 315 IPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 +PK +I +AIH DP + EPE+F P RF + P F+PF G ++C G Sbjct: 385 LPKGLNIIVPVYAIHYDPQHYPEPERFDPDRFTPEGCRQRAPYTFLPFGAGPKICIG 441 >AY062192-1|AAL58553.1| 151|Anopheles gambiae cytochrome P450 CYP4H17 protein. Length = 151 Score = 49.2 bits (112), Expect = 1e-07 Identities = 24/67 (35%), Positives = 34/67 (50%) Frame = +3 Query: 285 IEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQT 464 +ED + IP A + + +H +P V+ EPEKF P RF + P ++IPF Sbjct: 84 LEDMEMNGTTIPAGATISLNIFNVHRNPKVFPEPEKFIPERFSDANEIKRGPYDYIPFSA 143 Query: 465 GKRMCPG 485 G R C G Sbjct: 144 GPRNCIG 150 >AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CYP4H15 protein. Length = 151 Score = 49.2 bits (112), Expect = 1e-07 Identities = 23/65 (35%), Positives = 32/65 (49%) Frame = +3 Query: 291 DAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGK 470 D + IPK L +A+H DP ++ EP +F P RF + +P +IPF G Sbjct: 86 DMLIDGVTIPKGMDFGILIYALHNDPELYPEPARFDPERFSEEASEKRQPYSYIPFTAGP 145 Query: 471 RMCPG 485 R C G Sbjct: 146 RNCIG 150 >AY062199-1|AAL58560.1| 151|Anopheles gambiae cytochrome P450 CYP4H19 protein. Length = 151 Score = 48.4 bits (110), Expect = 2e-07 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +3 Query: 252 IIVPVG-IPHGCIEDAYLGNYRIPKNA-MVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDG 425 ++ PV I +ED + IP IP+ + IH +P V+ +PE+F P RF + Sbjct: 72 LLPPVSFIGRRLVEDIQMNGVTIPAGTDFTIPI-YVIHRNPAVFPDPERFDPERFSGANQ 130 Query: 426 SLLKPQEFIPFQTGKRMCPG 485 P ++IPF G R C G Sbjct: 131 HPPGPYDYIPFTAGPRNCIG 150 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 47.6 bits (108), Expect = 4e-07 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 4/84 (4%) Frame = +3 Query: 270 IPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQE- 446 +PH ED + Y + K +V + ++ W EP++F P R + + + ++ Sbjct: 39 VPHVATEDTCIAGYGVTKGTVVFINNYELNTSERYWSEPKRFNPSRENERTLQIERVRKN 98 Query: 447 ---FIPFQTGKRMCPGDELSRMLS 509 F+PF GKR C G L R S Sbjct: 99 IPHFLPFSIGKRTCIGQNLVRGFS 122 >AY062203-1|AAL58564.1| 149|Anopheles gambiae cytochrome P450 CYP4C25 protein. Length = 149 Score = 47.2 bits (107), Expect = 5e-07 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = +3 Query: 288 EDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTG 467 ED + Y +P + + + +H +P V+ P+KF P FL ++ P IPF G Sbjct: 84 EDVDIDGYVLPAGTTAMIVVYQLHRNPEVFPNPDKFNPDHFLPENCRGRNPYAXIPFSAG 143 Query: 468 KRMCPG 485 R C G Sbjct: 144 PRNCIG 149 Score = 29.5 bits (63), Expect = 0.10 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 76 GLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 G DTTS ++W LL + P Q+ I +EI Sbjct: 9 GHDTTSAAISWILLLLGTEPTIQDRIVEEI 38 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 46.8 bits (106), Expect = 6e-07 Identities = 22/53 (41%), Positives = 31/53 (58%) Frame = +3 Query: 327 AMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 A++IP+ AIH DP V+ PE+F P RF + + P + PF G R+C G Sbjct: 395 AVMIPVH-AIHHDPEVFPNPEQFDPERFSPEQEAKRHPYAWTPFGEGPRICVG 446 >AY062191-1|AAL58552.1| 151|Anopheles gambiae cytochrome P450 CYP4H16 protein. Length = 151 Score = 46.8 bits (106), Expect = 6e-07 Identities = 22/67 (32%), Positives = 33/67 (49%) Frame = +3 Query: 285 IEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQT 464 +ED + +P + + +H +P V+ EPEKF P RF + P ++IPF Sbjct: 84 LEDMEMNGTVVPAGTTISLNIFCLHRNPEVFPEPEKFIPERFSEANEIPRGPYDYIPFSA 143 Query: 465 GKRMCPG 485 G R C G Sbjct: 144 GPRNCIG 150 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 46.4 bits (105), Expect = 8e-07 Identities = 22/53 (41%), Positives = 31/53 (58%) Frame = +3 Query: 327 AMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 +++IP+ IH DP + EPE+F P RF A+ S P + PF G R+C G Sbjct: 335 SVMIPVL-GIHHDPEHFPEPERFDPERFTAEQESKRHPYAWTPFGEGPRICVG 386 >AY062198-1|AAL58559.1| 153|Anopheles gambiae cytochrome P450 CYP4J5 protein. Length = 153 Score = 46.0 bits (104), Expect = 1e-06 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = +3 Query: 270 IPHGCIEDAYLGNYRIPKNAMVIPLQ-WAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQE 446 I E+ +L + RI + L + +H DP + +PE+F P RFL + S P Sbjct: 80 ISRSVTEEIHLPDGRIIPQGCIANLHIFDLHRDPAQFPDPERFDPDRFLPECVSQRSPYA 139 Query: 447 FIPFQTGKRMCPG 485 +IPF G R C G Sbjct: 140 YIPFSAGPRNCIG 152 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 46.0 bits (104), Expect = 1e-06 Identities = 27/64 (42%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = +3 Query: 315 IPKNAMV-IPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPGDE 491 IP++ V IP+ +AIH DP + EPE F P RF A+ P F+PF G R+C G Sbjct: 400 IPRHVGVQIPV-YAIHHDPAHYPEPECFDPDRFSAEACRNRTPYTFLPFGEGPRVCIGMR 458 Query: 492 LSRM 503 M Sbjct: 459 FGMM 462 >AY748830-1|AAV28178.1| 95|Anopheles gambiae cytochrome P450 protein. Length = 95 Score = 45.6 bits (103), Expect = 1e-06 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +3 Query: 285 IEDAYLGNYRIPKNAMV-IPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQ 461 ++D + I K +V IP+ +H DP + P KF P RF ++ + P ++PF Sbjct: 28 VDDGDRLKFTIDKGTVVFIPIA-GLHHDPQYYPNPSKFDPERFSVENRDKINPNTYLPFG 86 Query: 462 TGKRMCPG 485 G R C G Sbjct: 87 IGPRNCIG 94 >AY745227-1|AAU93494.1| 99|Anopheles gambiae cytochrome P450 protein. Length = 99 Score = 45.6 bits (103), Expect = 1e-06 Identities = 21/62 (33%), Positives = 32/62 (51%) Frame = +3 Query: 300 LGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMC 479 L +Y IP ++ +AIH DP + P F P RF ++ ++P ++PF G R C Sbjct: 33 LHDYVIPNGMPIMIPIYAIHRDPKYFPNPTVFDPERFAKENLDQIQPCTYMPFGVGPRTC 92 Query: 480 PG 485 G Sbjct: 93 LG 94 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 45.6 bits (103), Expect = 1e-06 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +3 Query: 288 EDAYLGNYRIPKNA-MVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQT 464 +D + IP IP+ + IH +P V+ +PE+F P RF + P ++IPF Sbjct: 76 DDIEMNGVTIPAGTDFTIPI-YVIHRNPVVYPDPERFDPERFSDGNTQRRGPYDYIPFSI 134 Query: 465 GKRMCPG 485 G R C G Sbjct: 135 GSRNCIG 141 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 45.2 bits (102), Expect = 2e-06 Identities = 20/53 (37%), Positives = 32/53 (60%) Frame = +3 Query: 327 AMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 ++++P+ AIH DP + +PE+F P RF A+ + P + PF G R+C G Sbjct: 335 SVMVPVH-AIHRDPEHFPDPERFDPDRFTAEQEAKRHPYAWTPFGEGPRICIG 386 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 45.2 bits (102), Expect = 2e-06 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = +3 Query: 318 PKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMC 479 PK V+ +AIH D + + +PE++ P RF + KP FIPF G R+C Sbjct: 391 PKGMNVMIPVYAIHHDADNYPDPERYDPDRFAPEACESRKPYSFIPFGEGPRIC 444 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 45.2 bits (102), Expect = 2e-06 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 3/80 (3%) Frame = +3 Query: 330 MVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG---DELSR 500 ++IP+ +A+H DP + EPE+++P RF + + P ++PF G R+C G + Sbjct: 399 IMIPI-YAMHHDPAHFPEPEQYRPERFSPDEVARRDPYCYLPFGEGPRVCIGMRFGSIQA 457 Query: 501 MLSVAS*VDYSESSVFDSHQ 560 L +AS +D S D Q Sbjct: 458 KLGLASLLDRFRFSACDRTQ 477 >AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 44.0 bits (99), Expect = 4e-06 Identities = 22/52 (42%), Positives = 29/52 (55%) Frame = +3 Query: 330 MVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 ++IP+ AIHMDP + EP +F P RF + F+PF G RMC G Sbjct: 35 ILIPVL-AIHMDPKYYPEPHQFDPERFSPARKVTHEGATFLPFGEGPRMCLG 85 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 44.0 bits (99), Expect = 4e-06 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +3 Query: 315 IPKNAMV-IPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 IPK M+ IP+ +A+H D + +PE+F P RF + + ++PF G R+C G Sbjct: 398 IPKGTMIQIPI-YALHHDAQYYPDPERFDPERFRPEVANARPAYVYMPFGEGPRICIG 454 >AY748845-1|AAV28191.1| 102|Anopheles gambiae cytochrome P450 protein. Length = 102 Score = 43.6 bits (98), Expect = 6e-06 Identities = 19/62 (30%), Positives = 34/62 (54%) Frame = +3 Query: 312 RIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPGDE 491 R+ K + ++ + +H +P + EP++F+P RF A + P +IPF G R C G + Sbjct: 2 RLEKGSTIVFGTYMLHHNPEYFPEPDQFRPERF-ADGETKRNPFAYIPFSAGSRNCIGQK 60 Query: 492 LS 497 + Sbjct: 61 FA 62 >AY062193-1|AAL58554.1| 151|Anopheles gambiae cytochrome P450 CYP4D15 protein. Length = 151 Score = 43.6 bits (98), Expect = 6e-06 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 318 PKNAMVIPLQWAIHMDPNVWEEPEKFKPRRF-LAQDGSLLKPQEFIPFQTGKRMCPG 485 P + VI L + + DP+ + PEKF P RF + + P ++IPF G R C G Sbjct: 94 PAGSNVIVLPFFMGRDPDCFANPEKFDPERFNVERSAEKTNPYQYIPFTAGPRNCIG 150 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 43.6 bits (98), Expect = 6e-06 Identities = 20/50 (40%), Positives = 30/50 (60%) Frame = +3 Query: 336 IPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 IP+ +A+H DP + PE+F P RF A+ + P ++PF G R+C G Sbjct: 399 IPV-YALHHDPEHFPNPEQFDPDRFTAEQEAKRHPFVYLPFGEGPRICIG 447 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 43.2 bits (97), Expect = 8e-06 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = +3 Query: 315 IPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ---DGSLLKPQEFIPFQTGKRMCPG 485 IP+ +++ A+H DP + +P+ + P RF A G+ F+PF G R C G Sbjct: 174 IPQGTLLVVPVHALHRDPAYYPQPDVYNPDRFAASSKLSGASKNRPPFMPFGLGPRHCIG 233 Query: 486 DELSRML 506 D ML Sbjct: 234 DTFGLML 240 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 43.2 bits (97), Expect = 8e-06 Identities = 20/56 (35%), Positives = 32/56 (57%) Frame = +3 Query: 318 PKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 P ++IP +AIH DP+++ EP + P RF + + P ++PF G R+C G Sbjct: 403 PGMKIMIPA-YAIHHDPDIYPEPATYDPDRFTPERMARRDPCAYLPFGEGPRICIG 457 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 43.2 bits (97), Expect = 8e-06 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = +3 Query: 318 PKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 P ++IP+ +AIH D +++ +PE+F P RF F+PF G R C G Sbjct: 398 PDTMLMIPI-YAIHHDASIYPDPERFDPDRFALAATHARHTHAFLPFGDGPRNCIG 452 >AY062194-1|AAL58555.1| 151|Anopheles gambiae cytochrome P450 CYP4D16 protein. Length = 151 Score = 43.2 bits (97), Expect = 8e-06 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +3 Query: 285 IEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRF-LAQDGSLLKPQEFIPFQ 461 +EDA + P + I L + + +P + PEKF P RF + P +++PF Sbjct: 83 MEDAEINGKVFPAGSNTIILPFFLGRNPEFFPNPEKFDPERFNVETSAEKTNPYQYVPFS 142 Query: 462 TGKRMCPG 485 G R C G Sbjct: 143 AGPRNCIG 150 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 42.7 bits (96), Expect = 1e-05 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +3 Query: 330 MVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 + IP+ ++I D +++ EPEKF P RF A++ + P + PF G R+C G Sbjct: 395 LFIPI-FSIQRDASLFPEPEKFDPERFSAEEEAKRHPFAWTPFGEGPRVCIG 445 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 41.9 bits (94), Expect = 2e-05 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +3 Query: 285 IEDAYLGNYRIPKNAMVIPLQWAIHMDPNVW-EEPEKFKPRRFLAQDGSLLKPQEFIPFQ 461 ++D + IP++++++ +++H ++W + + F P RFL + FIPF Sbjct: 145 MKDIEIAGVHIPRDSLIVMSIFSMHRRKDIWGPDADLFDPDRFLPERSEGRSTNVFIPFS 204 Query: 462 TGKRMCPGDELSRMLSV 512 G R C G + MLS+ Sbjct: 205 AGSRNCIGGRYA-MLSM 220 >AY745218-1|AAU93485.1| 159|Anopheles gambiae cytochrome P450 protein. Length = 159 Score = 41.9 bits (94), Expect = 2e-05 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +3 Query: 300 LGNYRIPKNAMVIPLQWAIHMDPNVW-EEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRM 476 LG YR+P + ++ + IH +P W + ++F+P RF +G P +PF G R Sbjct: 82 LGQYRLPADIDIVIDIFDIHRNPAYWGSDADRFRPERF---EGLRHDPFALLPFSAGSRN 138 Query: 477 CPG 485 C G Sbjct: 139 CVG 141 >DQ013848-1|AAY40257.1| 304|Anopheles gambiae CYP325D1 protein. Length = 304 Score = 41.5 bits (93), Expect = 2e-05 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +3 Query: 288 EDAYLGNYRIPKNAMVIPLQWAIHMDPNVW-EEPEKFKPRRFLAQDGSLLKPQEFIPFQT 464 ED + IP+ V+ +A+H + W + E+F P RFL++ F+PF T Sbjct: 229 EDLTVEGQLIPRGTTVVVSLFALHRRKDFWGADAERFDPDRFLSERCKNRMGCAFMPFNT 288 Query: 465 GKRMCPGDELSRML 506 G R C G + + Sbjct: 289 GSRNCIGSRYAMQI 302 Score = 28.3 bits (60), Expect = 0.23 Identities = 13/46 (28%), Positives = 27/46 (58%) Frame = +1 Query: 28 MRDEQLHFLLADMFGAGLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 + D ++ + + GAG DTT+ +L L++A+ P Q ++ +E+ Sbjct: 139 LSDTEIVQNIYSIVGAGNDTTAHSLGHTCLFLAMHPAVQRKLYQEL 184 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 41.5 bits (93), Expect = 2e-05 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +3 Query: 315 IPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRF-LAQDGSLLKPQEFIPFQTGKRMCPG 485 IP A +I + + + + + EPEKF P RF + + P ++IPF G R C G Sbjct: 93 IPAGANLIIMPFFLGREARYFPEPEKFDPERFNVERSAEKTNPYQYIPFSAGPRNCIG 150 >AY745219-1|AAU93486.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +3 Query: 348 WAIHMDPNVWEEPEKFKPRRFLAQDG-SLLKPQEFIPFQTG 467 WA+H + + EPE+F P RF+ +D + +P FIPF G Sbjct: 64 WALHRSGDYYPEPERFSPERFVGKDVINAAQPSTFIPFGIG 104 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 41.1 bits (92), Expect = 3e-05 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +3 Query: 315 IPKNAMV-IPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPGDE 491 IPK A V IP+ +H DP + +P++F P RF ++ + ++PF G R C Sbjct: 421 IPKGATVFIPIA-GLHYDPRFYPDPDRFDPERFNDENKHKIPLGAYLPFGIGPRNCIASR 479 Query: 492 LSRM 503 + M Sbjct: 480 FALM 483 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 40.7 bits (91), Expect = 4e-05 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 1/82 (1%) Frame = +3 Query: 258 VPVGIPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFL-AQDGSLL 434 VPV I ED L RI + V + +H + + + E+F P RF A+D Sbjct: 55 VPV-IARIATEDTELLAERITRGTSVAIDIYTMHHSDDYFPDAERFDPDRFEGARDAQTF 113 Query: 435 KPQEFIPFQTGKRMCPGDELSR 500 P +IPF G R C G + ++ Sbjct: 114 NPYTYIPFSAGSRNCIGQKFAQ 135 >AY062201-1|AAL58562.1| 151|Anopheles gambiae cytochrome P450 CYP4D22 protein. Length = 151 Score = 40.7 bits (91), Expect = 4e-05 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 2/78 (2%) Frame = +3 Query: 258 VPVGIPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSL-- 431 VP+ I E+ LG +P+ + +H DP ++ +PE+F P RF A D ++ Sbjct: 75 VPI-IARRFTENVELGGKIVPEGSNFNIGIMHMHRDPTLFPDPERFDPERF-APDRTMEQ 132 Query: 432 LKPQEFIPFQTGKRMCPG 485 P ++PF G R C G Sbjct: 133 SSPYAYVPFTAGPRNCIG 150 >AY062200-1|AAL58561.1| 151|Anopheles gambiae cytochrome P450 CYP4G17 protein. Length = 151 Score = 40.7 bits (91), Expect = 4e-05 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQ 461 ED L NY IP V+ + IH +++ PE F P FL + +IPF Sbjct: 83 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPERTQNRHYYSYIPFT 142 Query: 462 TGKRMCPG 485 G R C G Sbjct: 143 AGPRNCIG 150 >AY745212-1|AAU93479.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 39.9 bits (89), Expect = 7e-05 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +3 Query: 282 CIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVW-EEPEKFKPRRFLAQDGSLLKPQEFIPF 458 C ED + IP+ + +A+H +VW + E F P RFL + P + PF Sbjct: 19 CSEDIEVDGNVIPRGTNFLFSIFALHRRTDVWGPDAEGFDPDRFLPERSQGRHPHAYAPF 78 Query: 459 QTGKRMCPG 485 G R C G Sbjct: 79 SMGSRDCIG 87 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 39.5 bits (88), Expect = 9e-05 Identities = 25/75 (33%), Positives = 33/75 (44%), Gaps = 7/75 (9%) Frame = +3 Query: 300 LGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ-------DGSLLKPQEFIPF 458 L YRIPK V+ A+ D + +P+ F P R+L G P F+PF Sbjct: 403 LQGYRIPKGTEVVMGTLALQRDAAYFPQPDAFLPERWLPDGQGMGIPSGKEAHPFIFLPF 462 Query: 459 QTGKRMCPGDELSRM 503 G R C G L+ M Sbjct: 463 GFGARSCIGKRLAMM 477 Score = 31.9 bits (69), Expect = 0.019 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +1 Query: 22 LYMRDEQLHFLLA-DMFGAGLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 L ++QL ++A DM AG+DTTS + L +A P +Q +RKE+ Sbjct: 306 LLKTNKQLAVVMAFDMIMAGIDTTSSSTFGILYCLAKNPSKQAILRKEL 354 >AY748849-1|AAV28195.1| 106|Anopheles gambiae cytochrome P450 protein. Length = 106 Score = 39.1 bits (87), Expect = 1e-04 Identities = 19/71 (26%), Positives = 33/71 (46%) Frame = +3 Query: 291 DAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGK 470 D + IP V+ + + DP + + ++F+P RFL + P ++PF TG Sbjct: 24 DMEIDGVTIPTGTEVMLNIYVMQNDPQYYPDADQFRPERFLQEP----PPYSYLPFSTGV 79 Query: 471 RMCPGDELSRM 503 R C G + + Sbjct: 80 RSCIGQRFAML 90 >AY748844-1|AAV28190.1| 107|Anopheles gambiae cytochrome P450 protein. Length = 107 Score = 39.1 bits (87), Expect = 1e-04 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 318 PKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 P ++ L +A H +++ +PE+F P RF P F+PF G R C G Sbjct: 1 PTGTEIMILPYATHRLEHIYPDPERFDPERF-GDGAPHQNPYAFLPFSAGPRNCIG 55 >AY745225-1|AAU93492.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 39.1 bits (87), Expect = 1e-04 Identities = 18/50 (36%), Positives = 30/50 (60%) Frame = +3 Query: 327 AMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRM 476 +++IP+ +AIH DP+++ P KF P RFL ++ F+ F G R+ Sbjct: 108 SVIIPV-YAIHYDPDIYPMPYKFDPDRFLEENRKSRPRHAFLGFGEGPRL 156 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 39.1 bits (87), Expect = 1e-04 Identities = 20/57 (35%), Positives = 28/57 (49%) Frame = +3 Query: 315 IPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 +P+ VI A H DP+ + +P FKP RF A ++PF G R+C G Sbjct: 389 LPEGVGVILPNLAFHYDPDYFPDPYDFKPERF-AVKNDFKNNFSYLPFGEGPRICIG 444 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 38.7 bits (86), Expect = 2e-04 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 7/79 (8%) Frame = +3 Query: 288 EDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSL-------LKPQE 446 +D L YR+PK +V Q + + + P +F P R+L+ + + + P Sbjct: 398 KDLVLQGYRVPKGILVGMGQLVLQREEGYFTRPSEFMPERWLSGEAAAGCPSAKEVHPFV 457 Query: 447 FIPFQTGKRMCPGDELSRM 503 ++PF G R C G L+ M Sbjct: 458 YLPFGFGARSCIGKRLAMM 476 Score = 29.9 bits (64), Expect = 0.076 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 61 DMFGAGLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 D AG+DTTS L +A PE+QE++R E+ Sbjct: 319 DSLFAGVDTTSSGSTGILYCLAKNPEKQEKLRAEL 353 >AY745207-1|AAU93474.1| 103|Anopheles gambiae cytochrome P450 protein. Length = 103 Score = 37.5 bits (83), Expect = 4e-04 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 4/70 (5%) Frame = +3 Query: 288 EDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFL--AQDGS--LLKPQEFIP 455 ED + YRIPK + + + ++FKP R+L AQ GS L P +P Sbjct: 13 EDTVICGYRIPKGVQCVFPNLVLGTMEEYVSDAQRFKPERWLKPAQGGSGDQLHPFASLP 72 Query: 456 FQTGKRMCPG 485 + G RMC G Sbjct: 73 YGYGARMCLG 82 >AY745206-1|AAU93473.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 36.3 bits (80), Expect = 9e-04 Identities = 23/60 (38%), Positives = 30/60 (50%) Frame = +3 Query: 330 MVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPGDELSRMLS 509 ++IPL I MD + EPE + P+RF Q + P + PF G R C G MLS Sbjct: 9 VIIPLL-GISMDEKYFPEPEVYMPQRFDEQAPN-YDPDAYYPFGLGPRNCIGLRQGIMLS 66 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 35.9 bits (79), Expect = 0.001 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 6/77 (7%) Frame = +3 Query: 291 DAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFL-AQDGSL-----LKPQEFI 452 D L YR+P + + + D + P +F P R+L +D S+ + P F+ Sbjct: 394 DIVLQGYRVPSDTDIAMGAQVLLRDEKYFHRPTEFIPERWLNDRDASIPSAKEVNPFIFL 453 Query: 453 PFQTGKRMCPGDELSRM 503 PF G R C G L+ M Sbjct: 454 PFGFGSRSCIGKRLAMM 470 Score = 30.7 bits (66), Expect = 0.044 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 61 DMFGAGLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 DM AG+DTTS L +A PE+Q ++R E+ Sbjct: 314 DMIFAGIDTTSAGSVAILYCLAKNPEKQAKLRAEL 348 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 35.1 bits (77), Expect = 0.002 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +3 Query: 315 IPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMC 479 IP+ VI A DP ++ +P FKP RF + + P ++ F G RMC Sbjct: 388 IPEGVGVIISNLAFQHDPTLFPDPLAFKPERFEDKTFAKTNP-SYLAFGDGPRMC 441 >AY748846-1|AAV28192.1| 147|Anopheles gambiae cytochrome P450 protein. Length = 147 Score = 34.7 bits (76), Expect = 0.003 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 28 MRDEQLHFLLADMFGAGLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 + DE + + G DTT+ ++W L +AL PE QE + +EI Sbjct: 35 LTDEDVREEVDTFMFEGHDTTTAGMSWALFLLALHPEVQERVHQEI 80 >AY062189-1|AAL58550.1| 151|Anopheles gambiae cytochrome P450 CYP4G16 protein. Length = 151 Score = 34.7 bits (76), Expect = 0.003 Identities = 15/57 (26%), Positives = 26/57 (45%) Frame = +3 Query: 315 IPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 +P A + + +H +++ P+ F P FL + + F+PF G R C G Sbjct: 94 VPAGATITVATFKLHRLESIYPNPDVFNPDNFLPEKQANRHYYAFVPFTAGPRNCIG 150 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 34.7 bits (76), Expect = 0.003 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 318 PKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQD-GSLLKPQEFIPFQTGKRMCPGDEL 494 P + + IP AI DP ++ EP++F P RF + G+ + + F G R C G Sbjct: 422 PGDGLWIPAA-AIMRDPQLFPEPDRFWPERFEPESAGAPVDSSAMLAFGLGPRNCIGSRF 480 Query: 495 SRM 503 + M Sbjct: 481 ALM 483 >AY745223-1|AAU93490.1| 83|Anopheles gambiae cytochrome P450 protein. Length = 83 Score = 33.5 bits (73), Expect = 0.006 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +3 Query: 375 WEEPEKFKPRRFLAQDGSLLKPQE---FIPFQTGKRMCPGDELSRM 503 +EEPE+F P RF G +E F+PF G R C G + M Sbjct: 1 YEEPERFNPDRFSPATGGTKVYREKGCFLPFGDGPRQCLGMRFALM 46 >AY062195-1|AAL58556.1| 139|Anopheles gambiae cytochrome P450 CYP4H18 protein. Length = 139 Score = 31.5 bits (68), Expect = 0.025 Identities = 19/65 (29%), Positives = 30/65 (46%) Frame = +3 Query: 258 VPVGIPHGCIEDAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLK 437 VP+ I +ED + IP + + IH + V+ EPE+F P RF + Sbjct: 76 VPI-IGRKLLEDMEINGAIIPAGTSISIKIFNIHRNRTVFPEPERFDPERFSEANEIKRG 134 Query: 438 PQEFI 452 P ++I Sbjct: 135 PYDYI 139 >AY748847-1|AAV28193.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 31.1 bits (67), Expect = 0.033 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 76 GLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 G DTT+ + W L +AL P+ Q ++ +EI Sbjct: 36 GHDTTTAGMCWALFLLALHPDIQHQVHQEI 65 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 31.1 bits (67), Expect = 0.033 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +3 Query: 330 MVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 ++IPL W+I M+ + +PE P RF + + PF G R C G Sbjct: 391 VIIPL-WSISMNEKYFPDPELHSPERF-DEATKNYDADAYYPFGAGPRNCIG 440 >AY825592-1|AAV70203.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 108 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 153 >AY825591-1|AAV70202.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 108 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 153 >AY825590-1|AAV70201.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825589-1|AAV70200.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825588-1|AAV70199.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825587-1|AAV70198.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825586-1|AAV70197.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 108 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 153 >AY825585-1|AAV70196.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 108 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 153 >AY825584-1|AAV70195.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 111 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 156 >AY825583-1|AAV70194.1| 160|Anopheles gambiae cytochrome P450 protein. Length = 160 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 111 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 156 >AY825582-1|AAV70193.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825581-1|AAV70192.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825580-1|AAV70191.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 120 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 165 >AY825579-1|AAV70190.1| 169|Anopheles gambiae cytochrome P450 protein. Length = 169 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 120 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 165 >AY825578-1|AAV70189.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 122 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 167 >AY825577-1|AAV70188.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 122 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 167 >AY825576-1|AAV70187.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825575-1|AAV70186.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825574-1|AAV70185.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825573-1|AAV70184.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825572-1|AAV70183.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825571-1|AAV70182.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825570-1|AAV70181.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 108 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 153 >AY825569-1|AAV70180.1| 157|Anopheles gambiae cytochrome P450 protein. Length = 157 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 108 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 153 >AY825568-1|AAV70179.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 122 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 167 >AY825567-1|AAV70178.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 122 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 167 >AY825566-1|AAV70177.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 120 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 165 >AY825565-1|AAV70176.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 120 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 165 >AY825564-1|AAV70175.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 122 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 167 >AY825563-1|AAV70174.1| 175|Anopheles gambiae cytochrome P450 protein. Length = 175 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 122 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 167 >AY825562-1|AAV70173.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825561-1|AAV70172.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825560-1|AAV70171.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825559-1|AAV70170.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825558-1|AAV70169.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825557-1|AAV70168.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825556-1|AAV70167.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 120 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 165 >AY825555-1|AAV70166.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 120 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 165 >AY825554-1|AAV70165.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 107 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 152 >AY825553-1|AAV70164.1| 156|Anopheles gambiae cytochrome P450 protein. Length = 156 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 107 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 152 >AY825552-1|AAV70163.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825551-1|AAV70162.1| 168|Anopheles gambiae cytochrome P450 protein. Length = 168 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825550-1|AAV70161.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 120 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 165 >AY825549-1|AAV70160.1| 166|Anopheles gambiae cytochrome P450 protein. Length = 166 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 120 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 165 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 120 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 165 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 120 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 165 >AY825546-1|AAV70157.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 121 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 166 >AY825545-1|AAV70156.1| 170|Anopheles gambiae cytochrome P450 protein. Length = 170 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 121 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 166 >AY825544-1|AAV70155.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AY825543-1|AAV70154.1| 172|Anopheles gambiae cytochrome P450 protein. Length = 172 Score = 30.7 bits (66), Expect = 0.044 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 288 EDAYLG--NYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ 419 ED L NY IP V+ + IH +++ PE F P FL + Sbjct: 119 EDVQLASKNYTIPAGTTVVIGTYKIHRREDLYPHPETFNPDNFLPE 164 >AF487535-1|AAL93296.1| 494|Anopheles gambiae cytochrome P450 CYP6Z1 protein. Length = 494 Score = 30.7 bits (66), Expect = 0.044 Identities = 20/60 (33%), Positives = 27/60 (45%) Frame = +3 Query: 330 MVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPGDELSRMLS 509 M+IPL I M+ + EPE + P RF + + PF G R C G +LS Sbjct: 391 MIIPLL-GISMNEKYFPEPELYSPERF-DEATKNYDADAYYPFGAGPRNCIGLRQGLLLS 448 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 30.3 bits (65), Expect = 0.058 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +1 Query: 61 DMFGAGLDTTSVTLAWFLLYMALFPEEQEEIRKEI 165 DM AG+DTTS L +A PE+Q ++R+E+ Sbjct: 321 DMLIAGIDTTSSGSTGVLYCLAKNPEKQAKLREEL 355 Score = 29.5 bits (63), Expect = 0.10 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 6/77 (7%) Frame = +3 Query: 291 DAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ---DGSLLK---PQEFI 452 D L Y+IPK + + + ++ P R+L++ D +K P F+ Sbjct: 401 DLVLQGYQIPKGTDIAMGSAVLQRSEKYFRRASEYLPERWLSERPADVPSVKDSNPFIFL 460 Query: 453 PFQTGKRMCPGDELSRM 503 PF G R C G L+ M Sbjct: 461 PFGFGARSCIGRRLAMM 477 >AY745210-1|AAU93477.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 28.7 bits (61), Expect = 0.18 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 9/74 (12%) Frame = +3 Query: 300 LGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQ----DGSLLKPQE-----FI 452 L Y + +V+ + + +++ ++F P R+L Q D + K E + Sbjct: 2 LSGYHLQAGTLVLCHTRVACLSEDNFQQADRFLPDRWLEQRDENDNVVNKRAEPGASVVL 61 Query: 453 PFQTGKRMCPGDEL 494 PF G+RMCPG ++ Sbjct: 62 PFGIGRRMCPGQKV 75 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 27.5 bits (58), Expect = 0.41 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +3 Query: 330 MVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 ++IPL +I M+ + +PE + P RF + + PF G R C G Sbjct: 391 VIIPLL-SISMNEKYFPDPELYSPERF-DEATKNYDADAYYPFGAGPRNCIG 440 >AY745216-1|AAU93483.1| 89|Anopheles gambiae cytochrome P450 protein. Length = 89 Score = 26.2 bits (55), Expect = 0.94 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 393 FKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 F P FL + + P F+PF G R C G Sbjct: 31 FDPDNFLPERTAHRHPYCFLPFSAGPRNCIG 61 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 529 IQKAAYSTRIKNTDSRRDAW 588 +Q AA S+ K SRR+AW Sbjct: 97 LQAAASSSSSKKNSSRRNAW 116 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = +3 Query: 366 PNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGKRMCPG 485 P W + + K G + P +PF G+R C G Sbjct: 21 PERWLKRGELKEHSGCPHAGQKIHPYVSLPFGYGRRTCIG 60 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 371 IRIHVNSPLQW 339 I +H+N PLQW Sbjct: 477 IELHLNGPLQW 487 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 786,830 Number of Sequences: 2352 Number of extensions: 17519 Number of successful extensions: 239 Number of sequences better than 10.0: 125 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 218 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -