Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0238
         (623 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q22R87 Cluster: Leucine Rich Repeat family protein; n=1...    33   5.6  

>UniRef50_Q22R87 Cluster: Leucine Rich Repeat family protein; n=1;
           Tetrahymena thermophila SB210|Rep: Leucine Rich Repeat
           family protein - Tetrahymena thermophila SB210
          Length = 579

 Score = 33.1 bits (72), Expect = 5.6
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = -2

Query: 259 PKLRYQETCSINRRPESLKPTLFMN---RPKKHF*GSSLIPQSKCHYSP*DV 113
           PK+RY++   + + P  +K   F++   RPK+   G +++ ++KC + P DV
Sbjct: 33  PKIRYRKGAKLTKNPYKIKKIPFIDDSKRPKRILDGYAILDEAKCEF-PNDV 83


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 584,897,097
Number of Sequences: 1657284
Number of extensions: 11388577
Number of successful extensions: 20478
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 19649
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20463
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 45636850930
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)