BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0238 (623 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 3.6 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.8 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 6.3 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 6.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 6.3 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 8.4 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 405 LHIIFLIWTITSTFGATIIVYTERE 479 L I+L W TS + ++YT R+ Sbjct: 19 LFFIYLYWQQTSNLTTSKLLYTYRQ 43 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 558 GTIVKCTVTKNVYP 517 G V+CTV+K YP Sbjct: 620 GVSVQCTVSKGDYP 633 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 571 KICNWHNSKVYRYKK 527 ++ NW +K RYKK Sbjct: 276 QVSNWFGNKRIRYKK 290 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 413 NIFNLDNNFNIWGHNNSVYRTGIFYSDKPI 502 N+F+ + + H N +YR I++ K + Sbjct: 467 NVFSGELPVFLQEHRNGMYRPSIYFISKTL 496 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 413 NIFNLDNNFNIWGHNNSVYRTGIFYSDKPI 502 N+F+ + + H N +YR I++ K + Sbjct: 467 NVFSGELPVFLQEHRNGMYRPSIYFISKTL 496 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.0 bits (42), Expect = 8.4 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = +3 Query: 411 IIFLIWTITSTFGATII 461 +IF++W I TF + Sbjct: 249 VIFILWHIVGTFSGIFL 265 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,252 Number of Sequences: 336 Number of extensions: 3384 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -