BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0238 (623 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 25 1.5 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 25 2.0 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 25 2.0 AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 25 2.6 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 6.0 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 23 7.9 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 23 7.9 AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 23 7.9 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 510 NDIIGLSE*NIPVLYTLLLWPQMLKLLSKLKILYVDFSNL 391 N+I+ LSE N +L + ++ +L K ++ + D SN+ Sbjct: 107 NEIVELSENNNALLQNFMELTELKHVLEKTQVFFSDKSNV 146 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 25.0 bits (52), Expect = 2.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 478 NILFRQAYYIVEIRINIFCNGTLYYCASYIFSRLKP 585 N+L Y + + ++C G++YY IFSR P Sbjct: 213 NVLVMCLMYTFPLIVILYCYGSIYY---EIFSRTNP 245 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 25.0 bits (52), Expect = 2.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 478 NILFRQAYYIVEIRINIFCNGTLYYCASYIFSRLKP 585 N+L Y + + ++C G++YY IFSR P Sbjct: 213 NVLVMCLMYTFPLIVILYCYGSIYY---EIFSRTNP 245 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 24.6 bits (51), Expect = 2.6 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 141 DCGINELPQKCFLGLFMKRVGFKDSGLLFMEQV 239 D ++ + KCF+ F+ + GF D + + V Sbjct: 81 DFSVDTMKAKCFVKCFLDKAGFIDDDGVIQQDV 113 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 6.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 550 SKVYRYKKCLSLFQRYNRLV*IKYSRSVY 464 S + Y+ CL F R+N + ++Y Y Sbjct: 698 SAIQMYENCLKKFYRHNNVEVMQYLARAY 726 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 478 SRSVYTIIVAPNVEVIVQI 422 +R+ Y +IVAP E+ +QI Sbjct: 247 TRNPYIVIVAPTRELAIQI 265 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 442 VEVIVQIKNIICRFF*FT*SL 380 V++ + I+ I CRFF F+ SL Sbjct: 181 VDLKIYIQEICCRFFTFSSSL 201 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 174 FLGLFMKRVGFKDSGL 221 FL F+KR GF SGL Sbjct: 75 FLMTFLKRYGFSASGL 90 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 633,358 Number of Sequences: 2352 Number of extensions: 12794 Number of successful extensions: 31 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -