BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0237 (649 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 2.5 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.5 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 7.8 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.0 bits (47), Expect = 2.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 1 GNHLTPYYEP*SCSYVDAKKYSKISLHFTASLD 99 G HL + +P S S + + + +HFTAS D Sbjct: 221 GRHLG-FLKPDSSSELATRLAEAVRIHFTASRD 252 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 2.5 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 476 RSPSILSGGALDSKSVTRKLFDDLAKLDLGVAIMEFLLMYEN 601 +S L+GG D +V R++ D + +D+ I Y+N Sbjct: 459 KSALSLAGGLYDEGTVRRRVAVDRSGIDINEEIQRNREFYKN 500 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 435 TGRYYHPAHFCREAVMRFGLKGGAAVVTILRP 340 +G Y PAH + R+ L A V T + P Sbjct: 438 SGEYEIPAHGLPPSATRYDLGAVATVGTTVAP 469 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,571 Number of Sequences: 438 Number of extensions: 3969 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -