Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0236
         (650 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q6BN91 Cluster: Debaryomyces hansenii chromosome E of s...    35   1.5  

>UniRef50_Q6BN91 Cluster: Debaryomyces hansenii chromosome E of
           strain CBS767 of Debaryomyces hansenii; n=1;
           Debaryomyces hansenii|Rep: Debaryomyces hansenii
           chromosome E of strain CBS767 of Debaryomyces hansenii -
           Debaryomyces hansenii (Yeast) (Torulaspora hansenii)
          Length = 922

 Score = 35.1 bits (77), Expect = 1.5
 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 3/69 (4%)
 Frame = -3

Query: 396 LQYNALFTKLRNVYILFNIAVITMYKTCKHINSTYYVT---SKCITGLIC*ILSKPFQKK 226
           L YN  F KL  +  L N +   +      ++S YY +   SK    L+  ILSK F  K
Sbjct: 693 LDYNLHFKKLERLLDLLNKSSKVLLDYISRLSSRYYFSWRISKAQNFLMDTILSKEFYDK 752

Query: 225 NISKFKSTL 199
           NI   K+TL
Sbjct: 753 NIGTSKTTL 761


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 595,684,715
Number of Sequences: 1657284
Number of extensions: 11451010
Number of successful extensions: 19514
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 18750
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19503
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 48760335122
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)