BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0236 (650 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB2B2.18 |||dubious|Schizosaccharomyces pombe|chr 2|||Manual 26 5.4 SPAC3H8.06 |aur1||inositol phosphorylceramide synthase |Schizosa... 25 7.2 >SPBPB2B2.18 |||dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 175 Score = 25.8 bits (54), Expect = 5.4 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -3 Query: 231 KKNISKFKSTLFLT*YNF---HVYV*NMFFYFIFF 136 KK + K++S L + +N +VY N FF FIFF Sbjct: 132 KKLLGKWESKLKIIKFNKLAKYVYEGNQFFLFIFF 166 >SPAC3H8.06 |aur1||inositol phosphorylceramide synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 214 FGYVFFLKWFTQYLTN 261 +GYV +L W T YLT+ Sbjct: 278 YGYVLWLCWCTMYLTH 293 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,691,934 Number of Sequences: 5004 Number of extensions: 56485 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -