BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0236 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93397-5|CAD89745.1| 375|Caenorhabditis elegans Hypothetical pr... 29 2.9 Z78410-11|CAB01639.2| 315|Caenorhabditis elegans Hypothetical p... 29 2.9 >Z93397-5|CAD89745.1| 375|Caenorhabditis elegans Hypothetical protein ZC482.8 protein. Length = 375 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = -2 Query: 160 HVFLFYFF*NLIVRHRHKVPNKSLNIFWVQAA*IVQFSILFLNIIHVYIIAR 5 H+++F FF NL H+H L Q I FS FLN++H+ I+ R Sbjct: 24 HIYMF-FFENL---HKHFELVTVLTDVTKQLYDIASFSGFFLNLVHLVILTR 71 >Z78410-11|CAB01639.2| 315|Caenorhabditis elegans Hypothetical protein C51E3.4 protein. Length = 315 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 457 LXSPCFIRIRITNIDDFKFICALFNYQHCI-LFNN 558 L SPC I I +T I D +CA F Y C+ LF N Sbjct: 40 LRSPCHILISLTCICDLLHLCAQFVY--CVHLFGN 72 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,504,546 Number of Sequences: 27780 Number of extensions: 304049 Number of successful extensions: 570 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -