Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0236
         (650 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g28270.1 68414.m03470 rapid alkalinization factor (RALF) fami...    28   6.2  
At1g61550.1 68414.m06934 S-locus protein kinase, putative simila...    27   8.2  
At1g61440.1 68414.m06923 S-locus protein kinase, putative contai...    27   8.2  

>At1g28270.1 68414.m03470 rapid alkalinization factor (RALF) family
           protein similar to RALF precursor [Nicotiana tabacum]
           GI:16566316
          Length = 110

 Score = 27.9 bits (59), Expect = 6.2
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -3

Query: 354 ILFNIAVITMYKTCKHINSTYYVTSKCITGLIC 256
           ++F + ++ M    K +N+TY +T  CI G  C
Sbjct: 7   LIFGLLILAM--VAKSVNATYPLTKSCINGQGC 37


>At1g61550.1 68414.m06934 S-locus protein kinase, putative similar
           to receptor protein kinase [Ipomoea trifida]
           gi|836954|gb|AAC23542; contains S-locus glycoprotein
           family domain, Pfam:PF00954
          Length = 802

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 32  YNSCIHNCSC 3
           Y SC+HNCSC
Sbjct: 364 YQSCLHNCSC 373


>At1g61440.1 68414.m06923 S-locus protein kinase, putative contains
           similarity to receptor protein kinase [Ipomoea trifida]
           gi|836954|gb|AAC23542; contains S-locus glycoprotein
           family domain, Pfam:PF00954
          Length = 792

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -1

Query: 32  YNSCIHNCSC 3
           Y SC+HNCSC
Sbjct: 362 YQSCLHNCSC 371


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,927,148
Number of Sequences: 28952
Number of extensions: 246812
Number of successful extensions: 388
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 382
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 388
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1354097952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)