BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0234 (692 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposa... 24 4.0 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 9.1 >AF378002-1|AAL16724.1| 336|Anopheles gambiae putative transposase protein. Length = 336 Score = 24.2 bits (50), Expect = 4.0 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +1 Query: 22 CHCKNYIYIFIFSQTINSINYNHELITKKII 114 C C +F+ ++T+ S Y E + K+I+ Sbjct: 194 CSCGKKTKVFVTNKTMTSELYQKECLQKRIL 224 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 9.1 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 454 WYP*ENRISLKFALSTCAKIQDE*LNNSISRQ 549 W P N+I K ALST +E L NSI Q Sbjct: 889 WIP-LNKIHKKLALSTEESSINEILMNSIQEQ 919 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 607,154 Number of Sequences: 2352 Number of extensions: 11308 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -