BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0231 (626 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF047661-5|AAU05544.1| 822|Caenorhabditis elegans Hypothetical ... 30 1.2 AF040653-4|ABS83854.1| 339|Caenorhabditis elegans Hypothetical ... 27 8.3 AC084159-8|AAK39361.2| 655|Caenorhabditis elegans Hypothetical ... 27 8.3 >AF047661-5|AAU05544.1| 822|Caenorhabditis elegans Hypothetical protein M70.4 protein. Length = 822 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/56 (35%), Positives = 28/56 (50%) Frame = +1 Query: 1 RHEIR*KKFLMKLYTFNK*SK*TQSNYVHLHSTKIERAQRYITHLNNNELNVLKKI 168 R EI+ + K F + TQ NY L +T+ E ++ Y+THLN N K I Sbjct: 693 RIEIQVDELEKKNVLFRRNRTATQQNY--LINTEFETSEEYLTHLNQLVQNTKKSI 746 >AF040653-4|ABS83854.1| 339|Caenorhabditis elegans Hypothetical protein K05F6.12 protein. Length = 339 Score = 27.5 bits (58), Expect = 8.3 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = -2 Query: 256 ISYPISDIKG*-RSLRINLRQCWL*LRNKIQFFLRHLIHYYSSELYISVHVQFWSNASVR 80 +S P+ ++K R+++I C L K + F+RH + LY+ V N S + Sbjct: 25 LSLPLDNLKDVFRNMKITELTCCSLLSTKTKHFIRHFCIFKELYLYVEVDYALEYNISFQ 84 Query: 79 NLTEFIC 59 + C Sbjct: 85 GVLLHSC 91 >AC084159-8|AAK39361.2| 655|Caenorhabditis elegans Hypothetical protein Y73B3A.3 protein. Length = 655 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 70 QSNYVHLHSTKIERAQRYITHLNNNELNVLKKI 168 Q NY L +T+ E ++ Y+THLN N K I Sbjct: 549 QQNY--LINTEFETSEEYLTHLNQLVQNTKKSI 579 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,349,104 Number of Sequences: 27780 Number of extensions: 226628 Number of successful extensions: 472 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1374536540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -