BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0231 (626 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g14180.1 68417.m02189 expressed protein ; expression supporte... 29 3.3 At3g28880.1 68416.m03605 ankyrin repeat family protein contains ... 27 7.7 >At4g14180.1 68417.m02189 expressed protein ; expression supported by MPSS Length = 1268 Score = 28.7 bits (61), Expect = 3.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 479 ICNCYSFIFINTLIKITCHHSPEFTRCQ 396 + N Y INT++ + C P T+CQ Sbjct: 901 VSNSYLVSAINTVVDVACSKGPALTQCQ 928 >At3g28880.1 68416.m03605 ankyrin repeat family protein contains ankyrin repeats, Pfam:PF00023 Length = 762 Score = 27.5 bits (58), Expect = 7.7 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 4/61 (6%) Frame = -2 Query: 184 LRNKIQ-FFLRHLIHYYSSELYISVHVQFWSNASVRNLTEFIC---FIC*KCKASLEISS 17 +RN FFLR Y S E + + FW N ++ F C C CK + S+ Sbjct: 645 IRNSTSVFFLREFDFYQSYETCLKEGMCFWCNKNMIRWANFPCRHKLWCSSCKQQITQST 704 Query: 16 T 14 + Sbjct: 705 S 705 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,246,137 Number of Sequences: 28952 Number of extensions: 194533 Number of successful extensions: 419 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -