BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0228 (445 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U57847-1|AAB02266.1| 84|Homo sapiens ribosomal protein S27 pro... 117 2e-26 L19739-1|AAA59867.1| 84|Homo sapiens metallopanstimulin protein. 117 2e-26 BC070219-1|AAH70219.1| 84|Homo sapiens ribosomal protein S27 (... 117 2e-26 BC003667-1|AAH03667.1| 84|Homo sapiens ribosomal protein S27-l... 117 2e-26 BC002658-1|AAH02658.1| 84|Homo sapiens ribosomal protein S27 (... 117 2e-26 AL358472-19|CAI14033.1| 84|Homo sapiens ribosomal protein S27 ... 117 2e-26 AB061845-1|BAB79483.1| 84|Homo sapiens ribosomal protein S27 p... 117 2e-26 BC047648-1|AAH47648.1| 113|Homo sapiens RPS27L protein protein. 112 5e-25 AB007162-1|BAA25825.1| 69|Homo sapiens ribosomal protein S27 p... 104 1e-22 AL358472-18|CAI14032.1| 66|Homo sapiens ribosomal protein S27 ... 42 0.001 Y17151-1|CAA76658.2| 1527|Homo sapiens multidrug resistance prot... 29 7.2 AJ294545-1|CAC69553.1| 1514|Homo sapiens multidrug resistance as... 29 7.2 AF104943-1|AAD04170.1| 1527|Homo sapiens ABC transporter MOAT-D ... 29 7.2 AF085691-1|AAD02846.1| 1238|Homo sapiens multidrug resistance-as... 29 7.2 AF085690-1|AAD02845.1| 1527|Homo sapiens multidrug resistance-as... 29 7.2 AF083552-1|AAC34668.1| 1527|Homo sapiens canalicular multispecif... 29 7.2 AF009670-1|AAD01430.1| 1528|Homo sapiens MRP3 protein. 29 7.2 AB208954-1|BAD92191.1| 1533|Homo sapiens ATP-binding cassette, s... 29 7.2 BC007355-1|AAH07355.1| 287|Homo sapiens solute carrier family 2... 29 9.6 AK075249-1|BAC11497.1| 287|Homo sapiens protein ( Homo sapiens ... 29 9.6 AJ131613-1|CAB59892.1| 287|Homo sapiens dicarboxylate carrier p... 29 9.6 AJ131612-1|CAB60007.1| 287|Homo sapiens dicarboxylate carrier p... 29 9.6 >U57847-1|AAB02266.1| 84|Homo sapiens ribosomal protein S27 protein. Length = 84 Score = 117 bits (282), Expect = 2e-26 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +2 Query: 86 LVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFK 256 LV PNSYFMDVKCPGCYKITTVFSHAQ VV+C GCST+LCQPTGG+ARLTEGCSF+ Sbjct: 24 LVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFR 80 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 16 MPLAIDLLHPSPASERRKHKLKR 84 MPLA DLLHPSP E+RKHK KR Sbjct: 1 MPLAKDLLHPSPEEEKRKHKKKR 23 >L19739-1|AAA59867.1| 84|Homo sapiens metallopanstimulin protein. Length = 84 Score = 117 bits (282), Expect = 2e-26 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +2 Query: 86 LVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFK 256 LV PNSYFMDVKCPGCYKITTVFSHAQ VV+C GCST+LCQPTGG+ARLTEGCSF+ Sbjct: 24 LVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFR 80 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 16 MPLAIDLLHPSPASERRKHKLKR 84 MPLA DLLHPSP E+RKHK KR Sbjct: 1 MPLAKDLLHPSPEEEKRKHKKKR 23 >BC070219-1|AAH70219.1| 84|Homo sapiens ribosomal protein S27 (metallopanstimulin 1) protein. Length = 84 Score = 117 bits (282), Expect = 2e-26 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +2 Query: 86 LVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFK 256 LV PNSYFMDVKCPGCYKITTVFSHAQ VV+C GCST+LCQPTGG+ARLTEGCSF+ Sbjct: 24 LVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFR 80 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 16 MPLAIDLLHPSPASERRKHKLKR 84 MPLA DLLHPSP E+RKHK KR Sbjct: 1 MPLAKDLLHPSPEEEKRKHKKKR 23 >BC003667-1|AAH03667.1| 84|Homo sapiens ribosomal protein S27-like protein. Length = 84 Score = 117 bits (282), Expect = 2e-26 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +2 Query: 86 LVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFK 256 LV PNSYFMDVKCPGCYKITTVFSHAQ VV+C GCST+LCQPTGG+ARLTEGCSF+ Sbjct: 24 LVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFR 80 Score = 36.3 bits (80), Expect = 0.048 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = +1 Query: 16 MPLAIDLLHPSPASERRKHKLKR 84 MPLA DLLHPS E++KHK KR Sbjct: 1 MPLARDLLHPSLEEEKKKHKEKR 23 >BC002658-1|AAH02658.1| 84|Homo sapiens ribosomal protein S27 (metallopanstimulin 1) protein. Length = 84 Score = 117 bits (282), Expect = 2e-26 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +2 Query: 86 LVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFK 256 LV PNSYFMDVKCPGCYKITTVFSHAQ VV+C GCST+LCQPTGG+ARLTEGCSF+ Sbjct: 24 LVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFR 80 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 16 MPLAIDLLHPSPASERRKHKLKR 84 MPLA DLLHPSP E+RKHK KR Sbjct: 1 MPLAKDLLHPSPEEEKRKHKKKR 23 >AL358472-19|CAI14033.1| 84|Homo sapiens ribosomal protein S27 (metallopanstimulin 1) protein. Length = 84 Score = 117 bits (282), Expect = 2e-26 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +2 Query: 86 LVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFK 256 LV PNSYFMDVKCPGCYKITTVFSHAQ VV+C GCST+LCQPTGG+ARLTEGCSF+ Sbjct: 24 LVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFR 80 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 16 MPLAIDLLHPSPASERRKHKLKR 84 MPLA DLLHPSP E+RKHK KR Sbjct: 1 MPLAKDLLHPSPEEEKRKHKKKR 23 >AB061845-1|BAB79483.1| 84|Homo sapiens ribosomal protein S27 protein. Length = 84 Score = 117 bits (282), Expect = 2e-26 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +2 Query: 86 LVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFK 256 LV PNSYFMDVKCPGCYKITTVFSHAQ VV+C GCST+LCQPTGG+ARLTEGCSF+ Sbjct: 24 LVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFR 80 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 16 MPLAIDLLHPSPASERRKHKLKR 84 MPLA DLLHPSP E+RKHK KR Sbjct: 1 MPLAKDLLHPSPEEEKRKHKKKR 23 >BC047648-1|AAH47648.1| 113|Homo sapiens RPS27L protein protein. Length = 113 Score = 112 bits (270), Expect = 5e-25 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = +2 Query: 86 LVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSF 253 LV PNSYFMDVKCPGCYKITTVFSHAQ VV+C GCST+LCQPTGG+ARLTEG SF Sbjct: 40 LVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGISF 95 Score = 31.9 bits (69), Expect = 1.0 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +1 Query: 22 LAIDLLHPSPASERRKHKLKR 84 LA DLLHPS E++KHK KR Sbjct: 19 LARDLLHPSLEEEKKKHKKKR 39 >AB007162-1|BAA25825.1| 69|Homo sapiens ribosomal protein S27 protein. Length = 69 Score = 104 bits (250), Expect = 1e-22 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +2 Query: 86 LVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLT 238 LV PNSYFMDVKCPGCYKITTVFSHAQ VV+C GCST+LCQPTGG+ARLT Sbjct: 19 LVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLT 69 Score = 35.1 bits (77), Expect = 0.11 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 31 DLLHPSPASERRKHKLKR 84 DLLHPSP E+RKHK KR Sbjct: 1 DLLHPSPEEEKRKHKKKR 18 >AL358472-18|CAI14032.1| 66|Homo sapiens ribosomal protein S27 (metallopanstimulin 1) protein. Length = 66 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 16 MPLAIDLLHPSPASERRKHKLKR 84 MPLA DLLHPSP E+RKHK KR Sbjct: 1 MPLAKDLLHPSPEEEKRKHKKKR 23 Score = 35.5 bits (78), Expect = 0.083 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +2 Query: 86 LVPHPNSYFMDVKCPG 133 LV PNSYFMDVKCPG Sbjct: 24 LVQSPNSYFMDVKCPG 39 >Y17151-1|CAA76658.2| 1527|Homo sapiens multidrug resistance protein 3 (ABCC3) protein. Length = 1527 Score = 29.1 bits (62), Expect = 7.2 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 81 AA*CHILTLISWMLSALAVTRLQQFLVTHREWWSALDAQRSFVN 212 AA H T +WM S VT + ++ + + + LDA+++FV+ Sbjct: 528 AAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVS 571 >AJ294545-1|CAC69553.1| 1514|Homo sapiens multidrug resistance associated protein protein. Length = 1514 Score = 29.1 bits (62), Expect = 7.2 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 81 AA*CHILTLISWMLSALAVTRLQQFLVTHREWWSALDAQRSFVN 212 AA H T +WM S VT + ++ + + + LDA+++FV+ Sbjct: 528 AAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVS 571 >AF104943-1|AAD04170.1| 1527|Homo sapiens ABC transporter MOAT-D protein. Length = 1527 Score = 29.1 bits (62), Expect = 7.2 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 81 AA*CHILTLISWMLSALAVTRLQQFLVTHREWWSALDAQRSFVN 212 AA H T +WM S VT + ++ + + + LDA+++FV+ Sbjct: 528 AAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVS 571 >AF085691-1|AAD02846.1| 1238|Homo sapiens multidrug resistance-associated protein 3A protein. Length = 1238 Score = 29.1 bits (62), Expect = 7.2 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 81 AA*CHILTLISWMLSALAVTRLQQFLVTHREWWSALDAQRSFVN 212 AA H T +WM S VT + ++ + + + LDA+++FV+ Sbjct: 528 AAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVS 571 >AF085690-1|AAD02845.1| 1527|Homo sapiens multidrug resistance-associated protein 3 protein. Length = 1527 Score = 29.1 bits (62), Expect = 7.2 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 81 AA*CHILTLISWMLSALAVTRLQQFLVTHREWWSALDAQRSFVN 212 AA H T +WM S VT + ++ + + + LDA+++FV+ Sbjct: 528 AAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVS 571 >AF083552-1|AAC34668.1| 1527|Homo sapiens canalicular multispecific organic anion transporter 2 protein. Length = 1527 Score = 29.1 bits (62), Expect = 7.2 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 81 AA*CHILTLISWMLSALAVTRLQQFLVTHREWWSALDAQRSFVN 212 AA H T +WM S VT + ++ + + + LDA+++FV+ Sbjct: 528 AAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVS 571 >AF009670-1|AAD01430.1| 1528|Homo sapiens MRP3 protein. Length = 1528 Score = 29.1 bits (62), Expect = 7.2 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 81 AA*CHILTLISWMLSALAVTRLQQFLVTHREWWSALDAQRSFVN 212 AA H T +WM S VT + ++ + + + LDA+++FV+ Sbjct: 529 AAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVS 572 >AB208954-1|BAD92191.1| 1533|Homo sapiens ATP-binding cassette, sub-family C, member 3 isoform MRP3 variant protein. Length = 1533 Score = 29.1 bits (62), Expect = 7.2 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +3 Query: 81 AA*CHILTLISWMLSALAVTRLQQFLVTHREWWSALDAQRSFVN 212 AA H T +WM S VT + ++ + + + LDA+++FV+ Sbjct: 534 AAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVS 577 >BC007355-1|AAH07355.1| 287|Homo sapiens solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), me protein. Length = 287 Score = 28.7 bits (61), Expect = 9.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 137 YKITTVFSHAQRVVVCAGCSTILCQP 214 Y +F+H + GC+T LCQP Sbjct: 194 YLSDNIFTHFVASFIAGGCATFLCQP 219 >AK075249-1|BAC11497.1| 287|Homo sapiens protein ( Homo sapiens cDNA FLJ90768 fis, clone THYRO1000795, highly similar to Mitochondrial dicarboxylate carrier. ). Length = 287 Score = 28.7 bits (61), Expect = 9.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 137 YKITTVFSHAQRVVVCAGCSTILCQP 214 Y +F+H + GC+T LCQP Sbjct: 194 YLSDNIFTHFVASFIAGGCATFLCQP 219 >AJ131613-1|CAB59892.1| 287|Homo sapiens dicarboxylate carrier protein protein. Length = 287 Score = 28.7 bits (61), Expect = 9.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 137 YKITTVFSHAQRVVVCAGCSTILCQP 214 Y +F+H + GC+T LCQP Sbjct: 194 YLSDNIFTHFVASFIAGGCATFLCQP 219 >AJ131612-1|CAB60007.1| 287|Homo sapiens dicarboxylate carrier protein protein. Length = 287 Score = 28.7 bits (61), Expect = 9.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 137 YKITTVFSHAQRVVVCAGCSTILCQP 214 Y +F+H + GC+T LCQP Sbjct: 194 YLSDNIFTHFVASFIAGGCATFLCQP 219 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,410,896 Number of Sequences: 237096 Number of extensions: 1204242 Number of successful extensions: 2112 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2112 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3659526016 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -