BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0228 (445 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF101312-3|AAC69219.1| 83|Caenorhabditis elegans Ribosomal pro... 109 1e-24 U58751-7|AAB00658.2| 729|Caenorhabditis elegans Hepatocyte grow... 28 3.5 U23517-8|AAM98041.1| 605|Caenorhabditis elegans A kinase anchor... 27 4.6 U23517-7|AAM98040.1| 1284|Caenorhabditis elegans A kinase anchor... 27 4.6 >AF101312-3|AAC69219.1| 83|Caenorhabditis elegans Ribosomal protein, small subunitprotein 27 protein. Length = 83 Score = 109 bits (261), Expect = 1e-24 Identities = 45/61 (73%), Positives = 53/61 (86%) Frame = +2 Query: 77 LSGLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTGGRARLTEGCSFK 256 L LV HPNSYFMDVKC GC+KI+TVFSHA VVVC GC+T+LCQPT G+A+LTEGCSF+ Sbjct: 21 LKRLVQHPNSYFMDVKCSGCFKISTVFSHATTVVVCVGCNTVLCQPTRGKAKLTEGCSFR 80 Query: 257 E 259 + Sbjct: 81 K 81 Score = 39.5 bits (88), Expect = 0.001 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +1 Query: 16 MPLAIDLLHPSPASERRKHKLKR 84 MPLA+DLLHP P E R HKLKR Sbjct: 1 MPLAVDLLHPEPQREIRCHKLKR 23 >U58751-7|AAB00658.2| 729|Caenorhabditis elegans Hepatocyte growth factor-regulatedtk substrate (hrs) family protein 1 protein. Length = 729 Score = 27.9 bits (59), Expect = 3.5 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 128 PGCYKITTVFSHAQRVVVCAGCSTILCQPTGGR 226 P CY+ +VFS R C C I C R Sbjct: 161 PECYRCRSVFSVFTRKHHCRACGQIFCDKCSSR 193 >U23517-8|AAM98041.1| 605|Caenorhabditis elegans A kinase anchor protein protein1, isoform c protein. Length = 605 Score = 27.5 bits (58), Expect = 4.6 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 116 DVKCPGCYKITTVFSHAQRVVVCAGCSTILC 208 D +CP C T F+ R C C +LC Sbjct: 541 DSECPNCMLCNTRFTIITRRHHCRACGRVLC 571 >U23517-7|AAM98040.1| 1284|Caenorhabditis elegans A kinase anchor protein protein1, isoform b protein. Length = 1284 Score = 27.5 bits (58), Expect = 4.6 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 116 DVKCPGCYKITTVFSHAQRVVVCAGCSTILC 208 D +CP C T F+ R C C +LC Sbjct: 541 DSECPNCMLCNTRFTIITRRHHCRACGRVLC 571 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,342,652 Number of Sequences: 27780 Number of extensions: 174403 Number of successful extensions: 393 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 767282256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -