BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0228 (445 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 2.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 2.6 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 4.6 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 4.6 DQ494417-1|ABF55368.1| 42|Apis mellifera telomerase reverse tr... 21 6.1 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 2.6 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = -3 Query: 293 GLCPGLKC*CCFL*KNILQLI*HGHQWVDKGS----LSIQRRP 177 G PG+ FL N L+ H W D G +IQ RP Sbjct: 1496 GQAPGIPPAATFLSPNSTTLVLRLHVWPDNGCPILYFTIQYRP 1538 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 2.6 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = -3 Query: 293 GLCPGLKC*CCFL*KNILQLI*HGHQWVDKGS----LSIQRRP 177 G PG+ FL N L+ H W D G +IQ RP Sbjct: 1492 GQAPGIPPAATFLSPNSTTLVLRLHVWPDNGCPILYFTIQYRP 1534 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.4 bits (43), Expect = 4.6 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = +1 Query: 154 F*SRTESGGLRWMLNDPLSTHWW 222 F R +G +W++N+ WW Sbjct: 24 FLKRPITGDEKWVVNNIKRKRWW 46 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 4.6 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 50 LRRRGGNISLSGLVPHPNSYFM 115 ++RR G + + L PH +YF+ Sbjct: 749 MKRRNGALIYNILPPHVAAYFL 770 >DQ494417-1|ABF55368.1| 42|Apis mellifera telomerase reverse transcriptase protein. Length = 42 Score = 21.0 bits (42), Expect = 6.1 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -1 Query: 178 HHSLCVTKNCCN 143 HH + + KN CN Sbjct: 24 HHKILIKKNKCN 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,146 Number of Sequences: 438 Number of extensions: 1990 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -