BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0227 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1024 - 10467644-10469274,10469424-10469482,10469820-104703... 31 1.1 02_05_0244 - 27130502-27130843,27130914-27131019,27132170-27132411 30 1.5 08_02_0934 + 22747742-22748644 29 4.6 04_04_1586 - 34621945-34623366 28 6.1 >12_01_1024 - 10467644-10469274,10469424-10469482,10469820-10470357, 10470975-10471666,10471912-10472062,10473797-10473864, 10473964-10474042,10474763-10474765,10476427-10477255 Length = 1349 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 384 LRASVTRYTCQRPSA-RSFRFLPFLSRHVRRLSPSSSK 274 + V Y CQ P ++FRF+ SRH R+ SS K Sbjct: 1306 VHTGVRPYECQEPGCGQTFRFVSDFSRHKRKTGHSSDK 1343 >02_05_0244 - 27130502-27130843,27130914-27131019,27132170-27132411 Length = 229 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -1 Query: 351 RPSARSFRFLPFLSRHVRRLSPSSSKSGAP 262 R SA R+ PFLSR +R S S+ SG P Sbjct: 191 RRSATDGRYAPFLSRQPQRSSAGSTHSGKP 220 >08_02_0934 + 22747742-22748644 Length = 300 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 375 SVTRYTCQRPSARSFRFLPFLSRHVRRLSPSSSKSGA 265 SV R +P+ SF LPF+ + R PSSS G+ Sbjct: 2 SVERDGRDQPNIDSFSQLPFIRQAAREKPPSSSSGGS 38 >04_04_1586 - 34621945-34623366 Length = 473 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 173 YQGDGPLREPSP*SSFLGSRCRKALNRTLKG 265 Y PL +P+ SSF G C A+ RTL G Sbjct: 165 YAQTDPLFDPAASSSFSGVSCGSAICRTLSG 195 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,369,019 Number of Sequences: 37544 Number of extensions: 342730 Number of successful extensions: 875 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -