BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0225 (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43690.1 68418.m05340 sulfotransferase family protein similar... 28 4.7 At4g30290.1 68417.m04305 xyloglucan:xyloglucosyl transferase, pu... 27 8.2 >At5g43690.1 68418.m05340 sulfotransferase family protein similar to steroid sulfotransferase 3 [Brassica napus] GI:3420008, steroid sulfotransferase 1 [Brassica napus] GI:3420004; contains Pfam profile PF00685: Sulfotransferase domain Length = 331 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +3 Query: 570 SGLKRNRMG--WLQHSFKFPFSTSEAGHWK 653 SGL+ N+ G W+ + +K F E G WK Sbjct: 276 SGLEVNKTGKTWMNYDYKSYFRKGEVGDWK 305 >At4g30290.1 68417.m04305 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to xyloglucan endotransglycosylase TCH4 GI:886116 from [Arabidopsis thaliana] Length = 277 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 471 WEESTENFATLCIPQNPRRL 530 W + T NF T CI NP+R+ Sbjct: 134 WFDPTANFHTYCITWNPQRI 153 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,998,247 Number of Sequences: 28952 Number of extensions: 156867 Number of successful extensions: 429 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -