BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0220 (644 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29980.1 68417.m04264 expressed protein 29 2.0 At5g25050.1 68418.m02969 integral membrane transporter family pr... 28 4.6 At3g12630.1 68416.m01572 zinc finger (AN1-like) family protein c... 28 6.1 >At4g29980.1 68417.m04264 expressed protein Length = 169 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +3 Query: 435 FLLLLSIIGLCSYTHF*YFTSGRNNYIVKIYLIIA*NGQFQFW 563 FLL+++II + S T + T+ +N KI + +G F+ W Sbjct: 10 FLLIIAIITITSSTSLPFLTTEQNQIATKIIDAMVSSGSFEDW 52 >At5g25050.1 68418.m02969 integral membrane transporter family protein similar to biopterin transporter (GI:3377706) [Leishmania mexicana]; contains 7 transmembrane domains; contains Pfam PF03092: BT1 family; contains TIGRFAMS TIGR00788: folate/biopterin transporter Length = 499 Score = 28.3 bits (60), Expect = 4.6 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 141 CSYKMKLFSVNFESSLIIVYRPHAMIGIEDYLF 43 C + LF+++ LI+V+R + G+ DYLF Sbjct: 331 CLWTQLLFALSGMLDLILVFRLNLKFGLPDYLF 363 >At3g12630.1 68416.m01572 zinc finger (AN1-like) family protein contains Pfam domain, PF01428: AN1-like Zinc finger Length = 160 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 637 LATDNCGLSKNERNNLMCRK 578 L T+NCG++ N N MC+K Sbjct: 25 LCTNNCGVTANPATNNMCQK 44 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,589,289 Number of Sequences: 28952 Number of extensions: 230947 Number of successful extensions: 455 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -