BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0218 (612 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranfe... 24 4.4 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.8 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 7.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 7.8 >AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranferase d9 protein. Length = 216 Score = 23.8 bits (49), Expect = 4.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 394 TGREKLVFHVSWLDAVLQDSA 456 T R+KL+ V+ LD +LQ SA Sbjct: 126 TDRQKLIEAVAVLDGILQHSA 146 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 7.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 445 AVQHPARRRGTRASPDRLIKTL 380 A + P RR G + PDR ++ L Sbjct: 72 APKKPTRRAGVKPQPDRPMRAL 93 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 7.8 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -2 Query: 260 AKQRLTSHCRNPRMTLXTFYQMRQLLIIIRNSKIQADTDYV 138 A RL RN + R + ++I+N +I A DY+ Sbjct: 2569 ADDRLVGFVRNDQFYSVWLDHERSVRLVIKNGEIVAAYDYL 2609 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 7.8 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -2 Query: 260 AKQRLTSHCRNPRMTLXTFYQMRQLLIIIRNSKIQADTDYV 138 A RL RN + R + ++I+N +I A DY+ Sbjct: 2570 ADDRLVGFVRNDQFYSVWLDHERSVRLVIKNGEIVAAYDYL 2610 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,194 Number of Sequences: 2352 Number of extensions: 11560 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -