Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0218
         (612 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g06350.1 68414.m00671 fatty acid desaturase family protein si...    27   9.8  

>At1g06350.1 68414.m00671 fatty acid desaturase family protein
           similar to delta 9 acyl-lipid desaturase (ADS1)
           GI:2970034 from [Arabidopsis thaliana]
          Length = 300

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 11/37 (29%), Positives = 19/37 (51%)
 Frame = -2

Query: 152 DTDYVK*WCSWNDNLFTKMQEILYEL*VTNIQIHLLL 42
           DT Y+K  C   DN+    ++  Y+     I +H+L+
Sbjct: 145 DTQYIKYKCGGRDNVLDLKKQWFYKFLRRTIAVHILM 181


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,514,511
Number of Sequences: 28952
Number of extensions: 231231
Number of successful extensions: 465
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 460
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 465
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1226538000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)