BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0217 (688 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025458-1|AAB70977.2| 384|Caenorhabditis elegans Hypothetical ... 27 9.5 AF000198-5|AAB53053.1| 381|Caenorhabditis elegans Hypothetical ... 27 9.5 >AF025458-1|AAB70977.2| 384|Caenorhabditis elegans Hypothetical protein C01B12.4 protein. Length = 384 Score = 27.5 bits (58), Expect = 9.5 Identities = 9/29 (31%), Positives = 19/29 (65%) Frame = +1 Query: 556 FWSMFRNLWELIIVLYLCNWKVFPSKTLF 642 +W+ F WE++++ LC++ + P+K F Sbjct: 276 WWASFMCTWEMMLLSALCSYCLRPAKCKF 304 >AF000198-5|AAB53053.1| 381|Caenorhabditis elegans Hypothetical protein T28F2.1 protein. Length = 381 Score = 27.5 bits (58), Expect = 9.5 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = -3 Query: 635 VLDGNTFQLHRYKTMI--SSHKFLNIDQKKFPGRLIKKFV 522 V+DG+ FQ H+Y + I S K+LN Q++ +L+KK + Sbjct: 159 VIDGHYFQSHKYFSSIETSIRKWLNPPQEE--EKLLKKMI 196 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,097,543 Number of Sequences: 27780 Number of extensions: 189093 Number of successful extensions: 346 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 346 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -