BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0217 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 26 0.29 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 23 2.1 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 2.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 6.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 6.3 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 6.3 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 26.2 bits (55), Expect = 0.29 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -3 Query: 635 VLDGNTFQLHRYKTMISSHK----FLNIDQKKFPGRLIKK 528 V G L YKT+ISSH +N D KF L+ K Sbjct: 40 VSSGFRSSLRNYKTLISSHDELPGHINCDSSKFEEDLMNK 79 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 23.4 bits (48), Expect = 2.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +1 Query: 547 GNFFWSMFRNLWELIIVLYLCNWK 618 GN W + L + I+ Y C WK Sbjct: 170 GNIRWELAGTLLLVWILCYFCIWK 193 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 558 LVNVQKFVGANHSFI 602 L+NV K++G H FI Sbjct: 103 LINVVKYLGGKHKFI 117 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +1 Query: 535 INRPGNFFWSMFRNLWELIIVLYLCNWK 618 I G+ W + L + I+ Y C WK Sbjct: 199 IENIGSIRWELAGTLAVVWIMCYFCIWK 226 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +1 Query: 535 INRPGNFFWSMFRNLWELIIVLYLCNWK 618 I G+ W + L + I+ Y C WK Sbjct: 252 IENIGSIRWELAGTLAVVWIMCYFCIWK 279 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 Query: 537 NKEVCLI*STGLASTLIPNEGIVH 466 N+ +C++ S A N GIVH Sbjct: 155 NERICILKSITCALQFCHNAGIVH 178 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,198 Number of Sequences: 438 Number of extensions: 2625 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -