BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0215 (635 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0071 + 12203227-12203368,12203551-12203703,12204622-122046... 29 3.1 >01_03_0071 + 12203227-12203368,12203551-12203703,12204622-12204683, 12204749-12204830,12206029-12206126,12206240-12206657, 12206793-12206915,12207159-12207178 Length = 365 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = -3 Query: 624 ILKPVNLVNYKGLNKYFIPKKYQSTLNQNNATNTSRHSWTFHLEK 490 +L+P NL+N KG N F ++ + Q+ T T R S T + K Sbjct: 275 VLRPPNLINAKGFNMSFNKEEINEAIYQSQLT-TRRVSATHAIAK 318 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,561,883 Number of Sequences: 37544 Number of extensions: 197539 Number of successful extensions: 298 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 297 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -